Conroe, TX 77303 • (7.3 miles) • Full Time • 9/21/2026

Why Pref-Tech?Voted "Top Workplaces" by Houston Chronicle and Austin American Statesman, 2 years in a row! We aim to make “family” a core reason we attract incredible people, retain them, and collectively deliver unequaled quality and service to customers. If your heart and mind are pushing you to join a team who deeply desires to be the best in the world, has a long-game approach to business, prides itself on doing exceptional work, celebrates service to others, and is willing to invest in you, you should consider Pref-Tech.Position Overview: The Security Systems Programmer Iplays a vital support role within the IT Services team, assisting in the deployment and validation of critical security technologies. This entry-level position is ideal for candidates eager to grow their technical ski

Houston, TX • (44.9 miles) • Full Time • 9/21/2026

Title: Cyber Security Project ManagerLocation: Hybrid (Houston, TX)Duration: Full-timeWe are looking for a Sr. Project Manager to manage cybersecurity projects, including firewall, Endpoint Protection, and network segmentation. The ideal candidate should be detail-oriented with a Stage Gate/waterfall PMO process. Needs to be a highly collaborative person, working closely with IT and Business stakeholders of the Program.Responsibilities:Manage Cyber Security projects such as Vulnerability Management, Firewall, Endpoint Protection, and Network Segmentation.Manage projects from business case to implementation.Project Management includes budget management, resource allocation, kick-off meetings, project planning, project execution and control, communication, risk analysis, quality assurance, t

Houston, TX • (44.9 miles) • Full Time • 9/21/2026

Location:Overseas, Camp Bondsteel Pristina, KosovoBenefits:First-Year Completion BonusTravel AllowanceAnnual PTO AllowanceContinuity Global Solutions CGS - Kosovo, LLC (CGS - Kosovo) is advertising in your community for an exciting opportunity to work overseas on a U.S. Government contract in the Eastern European Country of Kosovo -in the city of Pristina.Whether you are just looking for a job in an exciting location with opportunities for growth or simply want to get your foot in the door in Government contracting where we could help you gain or maintain a security clearance – this opportunity is for you!Summary:The Armed Security Guard provides security, installation access control, roving patrols, surveillance, monitoring and overall safeguarding to the installation and its tenants. Thi

Spring, TX 77373 • (26.2 miles) • Full Time • 9/20/2026

Benefits:Employee discountsOpportunity for advancementWellness resources Part-Time • Multiple Shift Opportunities • Weekend & On-Call Coverage Arcovia Security Group Inc. is hiring dependable Armed and Unarmed Security Officers. We have multiple types of shifts available throughout the week, including regular part-time shifts, weekend assignments, on-call coverage, and last-minute shift opportunities. LICENSE & CERTIFICATION REQUIREMENTS ARMED LEVEL IIIMust have your Level III license in handMust be fully licensed and ready to workWe will not assist with obtaining or completing your Level III certificationYou must be able to provide your credentials when requested UNARMED LEVEL IIMust have your Level II certification at minimumMust be properly licensed and ready to workOfficers must have t

Houston, TX • (44.9 miles) • Full Time • 9/20/2026

Lead Fire Alarm & Security InstallerProTech Fire & SecurityHouston, TXFull-Time$22 to $26 per HourJoin a Company Where Your Work MattersAre you an experienced Fire Alarm or Security Installer looking for a company where your skills are valued and your contributions are recognized?At ProTech Fire & Security, we are not a large corporate company where employees get lost in the shuffle. We are a locally owned business that has built our reputation on quality workmanship, strong customer relationships, and taking care of our team.Since 2007, ProTech has provided fire alarm, access control, surveillance, security, voice/data, and low-voltage solutions throughout Texas. We are looking for a Lead Fire Alarm & Security Installer who takes pride in their work, enjoys leading projects, and wants to

Houston, TX • (44.9 miles) • Full Time • 9/20/2026

Firetrol Protection Systems is seeking a highly skilled Fire Alarm and Security Service Technician to join our team. As a full-service fire protection, life safety, and security company, we design, install, repair, service, and inspect a wide variety of fire suppression, life protection, and integrated security systems. As a Service Technician, you will be responsible for maintaining and servicing the fire alarm systems for both new and existing customers. The ideal candidate should be highly organized, detail-oriented, and possess excellent communication skills. We value our team members and offer great benefits, growth opportunities, and a positive work culture.Responsibilities Conduct routine maintenance and repair of fire alarm and security systemsHave knowledge of multiple manufacture

Houston, TX • (44.9 miles) • Full Time • 9/20/2026

What You Will DoOur Security Officers protect the Industrial or Commercial property of our clients against fire, vandalism and illegal entry.Our clients range from Class-A Office Buildings, Luxury Residential Properties, Distilleries, Fortune 500 Companies, Financial Institutions, Telecommunications,Manufacturing/Industrial Factories, Hospitals and many others.Requirements:High School diploma or General Education Degree (GED)Minimum of 18 years of ageAbility to pass criminal background check and drug testSame Day Offers:interview with the hiring team and receive an offer to join us the same day!Extensive Training:Our initial training paves the way for you to earn your Security Officer Certification. Walden Security has been recognized byTraining Magazineas a Top 100 Award Winner which is a

Houston, TX 77090 • (29.3 miles) • Full Time • 9/19/2026

About the Company: Sungrow North America is a leading provider of renewable energy solutions, specializing in the development and manufacturing of photovoltaic inverters and energy storage systems. The company offers a comprehensive range of products and services designed to optimize the performance and efficiency of solar power installations. Sungrow North America aims to provide sustainable and reliable energy solutions to meet the growing demand for clean power and is known for its commitment to innovation, high-quality standards, and exceptional customer service.Security Engineer – Network & Identity:The Security Engineer (Network & Identity) is a hands-on engineering role within the IT team responsible for designing, implementing, securing, and automating Sungrow USA's network securit

Houston, TX 77008 • (43.9 miles) • Full Time • 9/19/2026

Benefits:Lifeguard Certification ClassFlexible scheduleFree uniformsOpportunity for advancementTraining & developmentLooking for a job where you can make a difference while having fun? Are you someone who stays alert, loves being around the water, and wants to help keep others safe? Become a Lifeguard and play an important role in creating a safe, fun, and welcoming environment for every swimmer! Job Title: Lifeguard Reports to: Deck Supervisor Summary: Under general supervision, ensures the safety of patrons of the Goldfish Swim School by preventing and responding to emergencies. 1. Maintains constant surveillance of patrons in the facility; acts immediately and appropriately to secure safety of patrons in the event of an accident or emergency. 2. Communicate the rules of the facility to

Houston, TX • (44.9 miles) • Full Time • 9/19/2026

Role: Cybersecurity / Network EngineerLocation: Houston, TX (Hybrid)Pay Range: $120,000 - $125,000 / yearBenefits: This position is eligible for medical, dental, vision and 401(k)About the RoleWe are seeking a Cybersecurity / Network Engineer to take ownership of a growing enterprise network and help shape the organization's long-term infrastructure and security strategy. This role combines hands-on network engineering with cybersecurity oversight, making it an excellent opportunity for someone who enjoys building secure, scalable environments while proactively identifying opportunities for improvement.The ideal candidate has experience managing enterprise network infrastructure, strengthening security posture, and partnering with third-party security providers to protect business operatio

Houston, TX • (44.9 miles) • Full Time • 9/19/2026

We are seeking a Commissioned Security Officerto become an integral part of our team. The selected individual will patrol and secure assigned premisesas well as identify risks to staff and patrons.Responsibilities:Monitor premises to prevent theft, violence, or infractions of rulesThoroughly examinedoors, windows, and gates to ensure proper function and securityWarnviolators of premise rules and regulationsApprehendor expelpersons engaging in suspicious or criminal actsReport anyfacility issues such as fire hazardsRequest emergency personnel for high risk situationsQualifications:Previous experience in security, law enforcement,or other related fieldsFamiliarity with security equipmentAbility to handle physical workloadStrong attention to detail\nCompany DescriptionIn Service Security LLCC

Houston, TX • (44.9 miles) • Full Time • 9/19/2026

Join Our Security Team!Are you looking for a stable, rewarding job with growth opportunities? We’re hiring dedicated security professionals! Here’s what we offer:What We Offer:- Set schedules available – Day, swing, and overnight shifts based upon availability.- 90-Day Raise and Performance Bonuses– Start building your career and earning more, fast.- Growth Opportunities– We promote from within for those ready to take the next step!Requirements:- Must Pass a Drug Test – This is a non-negotiable requirement.- Experience & Knowledge – Prior security experience is a plus, but we’re willing to train the right candidates.- Credentials – You must possess:- A valid Texas ID or Driver’s License.- A valid Social Security Card.- A current Non-Commission Security Guard License (Certificates are not a

Humble, TX • (33 miles) • Full Time • 9/18/2026

Fire Alarm/Portable Fire Extinguisher TechnicianAbout UsHouston Fire & Security is a highly respected full-service fire protection company that offers exceptional fire safety solutions for a diverse range of fire protection systems. We provide comprehensive services, including design, installation, repair, inspection, and maintenance, for commercial fire protection systems. With the ever-changing codes and regulations, we assist you in ensuring that your building complies with the latest standards. Whether it’s a mid-rise commercial or high-rise commercial building, we provide regularly scheduled fire protection inspections and maintenance to maintain the optimal functionality of your system.Job OverviewThis is a full-time on-site role for a Fire Alarm Technician based in Humble, TX. The F

Houston, TX 77086 • (35.4 miles) • Full Time • 9/18/2026

HomePro is seeking a skilled Install Technician in the fields of Security, AV, and Networking to join our vibrant team. If you are someone passionate about technology and customer satisfaction, we would love to hear from you.Role Overview This position involves the installation, maintenance, and troubleshooting of security, audio-visual (AV), and networking systems in residential and commercial spaces to meet clients' high expectations and ensure their satisfaction with our services.Why Join Us? Opportunity to work in a progressive tech environmentFull benefits package including health, dental, and vision insuranceCompetitive salaryPaid time off and company holidays401K with company matchContinuous learning and development opportunitiesTake home company vehicle & gas cardKey Responsibiliti

The Woodlands, TX • (17.9 miles) • Full Time • 9/18/2026

FULL-TIME POSITIONS AVAILABLEPriceless Protection Resources LLCTexas Private Security License: C28444101Job DescriptionPriceless Protection Resources LLC is seeking professional, dependable, and service-minded Level III Armed Security Officers for specialized church security assignments.Church security requires a unique balance of vigilance, professionalism, hospitality, sound judgment, and de-escalation. Officers must be able to maintain a strong security presence while interacting respectfully with church members, visitors, staff, volunteers, and ministry leadership.This is not a traditional stand-post position. Candidates must be prepared to actively patrol, monitor activity, support access control, respond to incidents and emergencies, and help maintain a safe and welcoming worship env

Houston, TX • (44.9 miles) • Full Time • 9/18/2026

One of the largest residential apartment communities in Southwest Houston is seeking a dependable, observant, and customer-service-oriented Unarmed Security Officer. In this role, you will maintain a safe, welcoming environment for residents and guests through active foot patrols, visitor logging, and clear daily communication.Key Responsibilities:Access Control & Visitor Logging: Greet residents and visitors, verify credentials, and maintain accurate visitor and vehicle logs at access points.Property Patrols: Perform routine, thorough foot patrols across property grounds, parking areas, and common amenities to deter unauthorized activity.Documentation & Reporting: Maintain detailed shift logs and draft clear, professional incident reports or daily correspondence.Resident Assistance & Serv

Spring, TX 77386 • (24 miles) • Full Time • 9/17/2026

We are seeking a Commissioned Security Officerto become an integral part of our team. The selected individual will patrol and secure assigned premisesas well as identify risks to staff and patrons.Responsibilities:Monitor premises to prevent theft, violence, or infractions of rulesThoroughly examinedoors, windows, and gates to ensure proper function and securityWarnviolators of premise rules and regulationsApprehendor expelpersons engaging in suspicious or criminal actsReport anyfacility issues such as fire hazards andleaking water pipesRequest emergency personnel for high risk situationsQualifications:Previous experience in security, law enforcement,or other related fieldsFamiliarity with security equipmentAbility to handle physical workloadStrong attention to detail

Houston, TX 77008 • (43.9 miles) • Full Time • 9/17/2026

Azure Infrastructure & Security AdministratorGet to Know Us: CG Infinity, Inc. is a technology consulting firm that was founded in 1998. We offer solutions that are tailored to the needs of each individual client that we work with instead of offering standard, run-of-the-mill solutions to everyone. We work closely with our clients throughout the entire process and offer solutions for a myriad of challenges. Our Culture: Our people-first approach to technology offers best-in-class service and customer success rates. Here are some of the main services that we offer at CG Infinity: Salesforce Implementations, Customer Experience & CRM, Application Development & Integration, Production Support & QA, and Data Analytics & AI. Position Overview: CG Infinity is seeking a motivated and detail-orien

Tomball, TX • (24.6 miles) • Full Time • 9/17/2026

Security Technician (Locksmith / Access Control / CCTV / Structured Cabling)Guardian Safe & Lock LLC – Houston, TX (Tomball Area)Guardian Safe & Lock LLC is one of the fastest-growing locksmith and security companies in the Houston metropolitan area. We specialize in access control, CCTV, and physical security integration, and we are looking for a motivated Security Technician to grow with us.This is not just a job, this is a long-term career opportunity with a company that is expanding year over year and building a strong, high-performing team.In this role, you will be responsible for installing, maintaining, troubleshooting, and repairing a wide range of security systems and related infrastructure. You will travel to residential, commercial, and industrial job sites performing a variety

Humble, TX 77396 • (35.9 miles) • Full Time • 9/17/2026

Fire Alarm/Portable Fire Extinguisher TechnicianAbout UsHouston Fire & Security is a highly respected full-service fire protection company that offers exceptional fire safety solutions for a diverse range of fire protection systems. We provide comprehensive services, including design, installation, repair, inspection, and maintenance, for commercial fire protection systems. With the ever-changing codes and regulations, we assist you in ensuring that your building complies with the latest standards. Whether it’s a mid-rise commercial or high-rise commercial building, we provide regularly scheduled fire protection inspections and maintenance to maintain the optimal functionality of your system.Job OverviewThis is a full-time on-site role for a Fire Alarm Technician based in Humble, TX. The F

Houston, TX • (44.9 miles) • Full Time • 9/16/2026

Are you an experienced Alarm Installer/AV Technician looking for a great opportunity? Join a company that values your skills and offers steady, rewarding work! This role focuses oncustomresidentialhomes. Ready to take the next step in your career? Apply today and join a team that values your expertise!Responsibilities:Install access door hardware (some wire pulling involved).Read and interpret plans and blueprints with confidence.Work independently while collaborating with a supportive team.Troubleshoot complex system issues and implement effective solutions.Build strong relationships with customers by providing efficient and reliable service.Conduct site surveys to assess installation requirements.Stay up to date with training and team meetings.Take on additional tasks as needed.Requirem

Houston, TX • (44.9 miles) • Full Time • 9/16/2026

Schedule (Open Availability Highly Preferred):Monday - Friday 8am-4:30amTuesday - Saturday 6am-2:30pmPay Range:$17 hourlyAbout CarvanaAt Carvana, we believe buying a car the old-fashioned way sucks so we're rewriting the playbook. Yes, we're the vending machine people. Yes, we built that on purpose. And yes, we're just getting started.We're looking for people who want tothrive in an environment of impactful change. Team spirit shows up in everything we do every day, our passion and creativity drive the kind of innovation that moves an industry. We take big swings, set ambitious goals, and challenge each other to make data- and process-driven decisions in everything we do. Here are a few of our stories. We've been changing the game since 2013, and we're not letting up. Want the full story?

Tomball, TX 77375 • (24.2 miles) • Full Time • 9/15/2026

About Us We’re a growing Managed Services Provider (MSP) dedicated to supporting credit unions with their IT and cybersecurity needs. Our mission is simple: keep our clients’ technology secure, reliable, and running smoothly so they can focus on serving their members. We value teamwork, curiosity, and innovation, and we believe that doing great work should also be fun. If you’re eager to build your cybersecurity career in a supportive, fast-growing environment, you’ll feel right at home here.The Position: The Security Analyst is an entry-level cybersecurity professional responsible for monitoring, analyzing, and supporting our client's organization’s security. This role focuses on operational security and works closely with outsourced Security Operations Centers (SOCs), internal Informatio

Houston, TX 77073 • (30.3 miles) • Full Time • 9/15/2026

HSSE AdvisorMake An Impact With USThe HSSE Advisor will be a business representative for health, safety, security and environmental (HSSE) programs, ensuring compliance with Vallourec policies and standards, maintaining compliance with ISO Certification standards, and all local, state, and federal regulations. An HSSE Advisor is responsible for promoting a proactive HSSE culture and driving a continuous improvement-based HSSE management system. An HSSE Advisor will collaboration across business departments to align/standardize health, safety, security and environmental programs. An HSSE Advisor is responsible to support development of World Best in Class programs in HSSE Leadership, Management Systems and Culture to deliver on Vallourec’s ambitions for 2030 and beyond.Your Role at a Glance

Houston, TX 77064 • (35.3 miles) • Full Time • 9/15/2026

Alarm TechnicianHouston, TXDescription Alarm TechnicianReports to Operations TeamAn alarm technician is responsible for installing, maintaining, and repairing fire and security alarm systems in homes and businesses.Core Values:Be Respectful, Be Accountable, Be ExceptionalWe Offer:- Competitive pay- Great benefits package- Excellent growth opportunitiesLocation: Houston, TXPosition Summary: This is a great opportunity for applicants with strong alarm security installation and service skills who want to provide excellent customer satisfaction services.Job Requirements-- To be able to install and service commercial alarm systems- install alarm devices and accessories- program alarm systems- train customers on alarm systems- Testing systems to ensure proper functionality- Diagnosing and repair

Houston, TX 77040 • (38.5 miles) • Full Time • 9/15/2026

Description: Objective:Installation Helper to assist in the installation, maintenance, and servicing of fire alarm systems. The ideal candidate will have a basic understanding of electrical systems, excellent attention to detail, and a strong willingness to learn and grow within the field. This role provides hands-on experience in the fire safety industry while working alongside experienced technicians.ResponsibilitiesAssist in the installation and maintenance of low voltage systems.Help troubleshoot and repair low voltage systems and components.Work with the technician to test and inspect low voltage systems for proper operation.Support the setup and wiring of low voltage equipment, including control panels, and devices.Handle tools, equipment, and materials related to low voltage systems

Houston, TX 77008 • (43.9 miles) • Full Time • 9/15/2026

Benefits:Company carCompetitive salaryDental insuranceEmployee discountsHealth insuranceOpportunity for advancementPaid time offAudio/Video & Security Installation TechnicianiEvolve Technology LLC Location: Greater Houston Area, TX Job Type: Full-Time Compensation: Based on Experience About Us iEvolve Technology is a growing technology integration company specializing in residential and commercial security systems, surveillance cameras, access control, audio/video solutions, and smart home automation. We are committed to delivering exceptional customer experiences and high-quality installations. We are seeking a motivated, dependable, and technically skilled Installation Technician to join our team. Position Summary The Audio/Video & Security Installation Technician is responsible for inst

Houston, TX • (44.9 miles) • Full Time • 9/15/2026

Exciting Security / Soc Analyst III, 6 months contract opportunity in Houston, TX.Requirements5 plus years experience in the security domain, Incident Response, threat monitoring, and handling incidents (incident triage and response)Determine detection requirements for data sources being on-boarded to the SIEM, and assessing the value of in place SIEM detection cases, in order to determine gaps and overlap in the overall detection scheme.Perform security monitoring and incident response of cyber security events for proper determination of being considered a cybersecurity event.Triage offenses for false positivesHands-on experience defining detection or protection schemes based on industry standards and frameworks.SIEM, Endpoint Detection and Response, Firewall/IPS/IDS, Proxy, Data Loss Pre

Houston, TX • (44.9 miles) • Full Time • 9/15/2026

**Job Title: PRN Security Officer - Independent & Assisted Living Facility****Job Description:**We are seeking a dedicated and professional PRN Security Officer to join our team at our Independent and Assisted Living Facility. This position requires a reliable individual who is committed to maintaining the safety and security of our residents and staff, and who can work on an as-needed basis to support our facility’s operations.**Key Responsibilities:**- Monitor and patrol assigned areas to provide a safe and secure environment for residents, staff, and visitors. - Respond swiftly to emergency situations, ensuring the appropriate procedures are followed to maintain safety. - Report any suspicious activities, safety hazards, or other security concerns to management immediately. - Operate su

Houston, TX • (44.9 miles) • Full Time • 9/15/2026

Job Summary: This position is responsible for the installation and activation of monitored security systems through the Company. Is responsible for trouble shooting and repairing these systems when needed. It also helps with other low voltage/AV/network installations of products purchased by the customer.Responsibilities:Basic alarm panel programming.· Basic networking knowledge from router set up, terminating all fittings (Cat 5, Cat 6, R66, BNC, etc.) and inserts.· Speaker installs and volume controls.· Able to find cables or tone cables in walls.· Assists with television hangs.· Able to install WI-FI packages.· Activations for Alarm.com and Total Connect.· Able to install cameras and DVRs.· Knowledge of security panels.· Television hangs without help.· Able to hook up audio/amps.· Proje

Houston, TX • (44.9 miles) • Full Time • 9/15/2026

First Response Solution - Security Officer (Commissioned/Non-Commissioned)Position Type: Part and Full TimePay Rate: starting pay at $12/hour (DOE)At First Response Solution, we are committed to delivering unparalleled security services rooted in integrity, professionalism, and real-world expertise. We are seeking dedicated, motivated Security Officers to join our team and help us protect our clients' assets and ensure the safety of their personnel.Responsibilities:Patrol and monitor assigned posts to prevent and detect security breaches.Enforce client-specific rules and regulations, as well as company policies and procedures.Conduct regular checks of assigned areas to ensure safety and security.Respond to alarms, emergencies, and other security incidents, providing assistance and maintain

Prairie View, TX • (38.6 miles) • Full Time • 9/11/2026

Fortinet Network Security EngineerWe are looking for a hands-on Fortinet expert with strong experience working with Fortinet network security solutions.The primary requirement for this role is deep, practical Fortinet experience. We are looking for someone who has worked extensively with Fortinet technologies and can independently configure, manage, troubleshoot, and support Fortinet environments.What we're looking for:Strong hands-on experience with Fortinet / FortiGateConfiguration, administration, and troubleshooting of Fortinet firewallsExperience with firewall policies, NAT, VPNs, security profiles, and related Fortinet security featuresExperience managing and troubleshooting Fortinet environments in productionFamiliarity with FortiManager and FortiAnalyzer is preferredAbility to inde

Houston, TX • (44.9 miles) • Full Time • 9/11/2026

HIRING NOW!!!We are seeking a Security Officers (Commissioned and Non-Commissioned) and Response Officers to become an integral part of our team. The selected individual will patrol and secure assigned premises as well as identify risks to staff and patrons.Qualifications:Must have reliable transportationMust have TX Driver's License & SS CardMust have working phoneMust be at least 21 years of ageMust have a clear criminal backgroundPay Rate: $18.00 Benefits include Weekly Pay, Holiday Pay, Direct Deposit, Company paid uniforms, Paid Vacations, 401K Plan, and Medical and Dental Plans. Officer of the Quarter AwardMust apply in person at: 1616 S. Voss, Houston, TX 77057, Suite #250 Monday-Friday 8:30 am to 3:30 pm.\nCompany DescriptionIn business since 1994, Locke Protective Services is the

Houston, TX • (44.9 miles) • Full Time • 9/10/2026

SECURITY OFFICERS - NON AND COMMISSIONEDTri Shield Security & Investigations Currently has an opening for a Full time Commission Security Officers to serve in the Houston area and must have level lll card in hand.*******************************************************************************************************We are seeking Experienced Security Officers with a positive attitude, customer service experience, great work ethics, and those who can work alone as well as with others. The ideal Security Officer is safety focused, an effective communicator, detail oriented, and ready to serve and protect the public and our clients.Position Details:(Full-time Level 3 Commissioned)Candidates with Criminal Justice, military, police, and Commissioned security experience are encouraged to apply.SE

Houston, TX 77008 • (43.9 miles) • Full Time • 9/10/2026

Benefits:Free uniformsOpportunity for advancementTraining & developmentFlexible scheduleSaving and changing lives, every single day. We have a mission to teach kids how to swim and be safer, in and around the water, while making their experience GOLDEN! Working for Goldfish Swim School will allow you to provide children and families with necessary life skills to combat the ever-growing drowning statistics. Whether you are in the pool leading instruction for our swimmers or warmly greeting our members in our tropical lobby as a front desk representative, you are making an impact. Perks and Benefits:Paid on-the-job trainingFlexible schedulingCulture driven companyEmployee recognition programsPrimary Responsibilities:Keep swimmers safe with lifeguard supervisionProvide any first aid necessary

Houston, TX 77066 • (32.8 miles) • Full Time • 9/9/2026

Job Summary:The Fire Alarm Technicianis responsible forthe installation, testing, inspection, service, and repair of fire alarm systems. Respond to emergency and maintenance calls and troubleshoot/replace faulty devices to restore alarm panels to “normal condition”.Complete inspection and service reports.Supervisory Responsibilities:NoneEssential Job Functions:Traveltocustomerlocationstoperforminstallation,service,andupgradesoffirealarmsystems.Respondtoemergencysituationsduringandafterbusinesshourstoresolvesafetyconcerns.PerformAnnualandSemi-annualinspectionofLifeSafetySystems.Write and provide inspection/service reports on tested equipment and devices.Indicate any deficiencies or corrections that need tobemade.Troubleshootanddiagnosefaultsormalfunctionsinfirealarmsystemsandtakeappropriate

Houston, TX • (44.9 miles) • Full Time • 9/9/2026

Digi Security Systems is an industry leader in the design, installation and support of custom video surveillance, electronic access control, and intrusion detection solutions for public and private partners. We've built our reputation on innovation and reliable service, and we're known as the industry's experts.Position OverviewDigi Security Systems is seeking an experienced low voltage Project Manager to oversee the planning and execution of high-level commercial security systems projects. A PMP certification (or equivalent project management certification) required.This role involves managing teams responsible for installation, service, troubleshooting, and programming of systems including video surveillance, electronic access control, and intrusion detection. Preference will be given to

Houston, TX 77041 • (39.8 miles) • Full Time • 9/8/2026

Are you a lead-generating, prospecting, relationship-building, sales machine? Do you love the challenge of discovering potential clients, reaching out to them, and maintaining relationships? If so, we should talk.We arePower Plus!A multi-industry leader in providing power when you need it, where you need it through intelligent and efficient power solutions. We work with Fortune 100 companies across the country such as Amazon, Wal-Mart, Costco, and more. We’ve built a more than 35-year reputation for excellence through our commitment to developing our people, providing exceptional, relationship-based customer service, and giving back to the community. Our biggest differentiator is the quality of our people, and the working environment we create for them, which really has to be seen to be be

Huntsville, TX 77340 • (15.1 miles) • Full Time • 9/4/2026

Armed and Unarmed officer Hiring:Best to email Resume & Guard Card to: Responsibilities and Duties: Security officer tasks may include but not limited to:Securing premises and personnel by patrolling property; monitoring surveillance equipment; inspecting buildings, equipment, and access points; permitting entry. Obtains help by sounding alarms. Prevents losses and damage by reporting irregularities; informing violators of policy and procedures; restraining trespassers, identifying risks and notifying appropriate management authority or 911/Police. Completes reports by recording observations, information, occurrences, and surveillance activities. Maintain a written log of all daily activities per shift.

Spring, TX 77388 • (25.7 miles) • Full Time • 9/4/2026

NON-COMMISSIONED Level 2 Security Guard Some alternating exterior foot patrols at some locations. Some locations require scans as part of the patrol. Must maintain communications with dispatch during shift. Prior security, military or LE experience a plus - an excellent opportunity for retirees. Required gear (must bring to interview): - Must have current security license or at least 1 year of security experience. Required: The experience required for these positions includes, but is not limited to: - Must be professional in appearance, skillset, and attitude. - Must be at least 21 years of age. - Must have reliable and dependable transportation. - Must have a smartphone. - MUST BE ABLE TO START IMMEDIATELY!!! - All employees must be able to pass a criminal background check, reference/prev

Houston, TX 77064 • (35.3 miles) • Full Time • 9/3/2026

Security Control Room Coordinator (IB3) Location: Houston, TX 77064 Business Unit:CESBG Job Classification: None- Exempt SUMMAR Operation and supervision of technical equipment incontrol room in order to monitor persons, assets, and ongoing processes within the plant area, and to respond immediately to extraordinary events and emergency signals.Preparing daily reports on the operation and condition of the technical equipment managed, as well as on events occurring during the shift KEY RESPONSIBILITIESAlarm response: Operate installed technical devices, monitor signals, and prepare reports on triggering events. All relevant data must be documented (e.g., alarm, acknowledgment, intervention initiated, persons involved, detailed documentation of actions taken).Continuously monitor CCTV images