Please Accept our Privacy Policy
HomePro
Houston, TX 77086 • (23.4 miles) • Full Time • 9/17/2026
HomePro is seeking a skilled Install Technician in the fields of Security, AV, and Networking to join our vibrant team. If you are someone passionate about technology and customer satisfaction, we would love to hear from you.Role Overview This position involves the installation, maintenance, and troubleshooting of security, audio-visual (AV), and networking systems in residential and commercial spaces to meet clients' high expectations and ensure their satisfaction with our services.Why Join Us? Opportunity to work in a progressive tech environmentFull benefits package including health, dental, and vision insuranceCompetitive salaryPaid time off and company holidays401K with company matchContinuous learning and development opportunitiesTake home company vehicle & gas cardKey ResponsibilitiMAVERICK REIGN LLC
Spring, TX 77386 • (9.4 miles) • Full Time • 9/17/2026
We are seeking a Commissioned Security Officerto become an integral part of our team. The selected individual will patrol and secure assigned premisesas well as identify risks to staff and patrons.Responsibilities:Monitor premises to prevent theft, violence, or infractions of rulesThoroughly examinedoors, windows, and gates to ensure proper function and securityWarnviolators of premise rules and regulationsApprehendor expelpersons engaging in suspicious or criminal actsReport anyfacility issues such as fire hazards andleaking water pipesRequest emergency personnel for high risk situationsQualifications:Previous experience in security, law enforcement,or other related fieldsFamiliarity with security equipmentAbility to handle physical workloadStrong attention to detailAllied Universal
Spring, TX 77386 • (9.4 miles) • Full Time • 9/17/2026
Overview Allied Universal®, North America’s leading security and facility services company, offers rewarding careers that provide you a sense of purpose. While working in a dynamic, welcoming, and collaborative workplace, you will be part of a team that contributes to a culture that positively impacts the communities and customers we serve. Job Description As a Armed Security Officer - Rayford Rdin Spring, TX, you will serve and safeguard clients in a range of industries such as Retail/Malls, and more. Join a leading team where flexibility meets opportunity. As a Part-Time Security Officer, you can build a schedule that works for you and explore new roles using our Claim a Shift platform. Learn more: aus.com/earnmore. As an Armed Patrol Officer at a retail location, you will conduct routinCG Infinity
Houston, TX 77008 • (27.6 miles) • Full Time • 9/17/2026
Computer Technician (Azure Network Security)Get to Know Us: CG Infinity, Inc. is a technology consulting firm that was founded in 1998. We offer solutions that are tailored to the needs of each individual client that we work with instead of offering standard, run-of-the-mill solutions to everyone. We work closely with our clients throughout the entire process and offer solutions for a myriad of challenges. Our Culture: Our people-first approach to technology offers best-in-class service and customer success rates. Here are some of the main services that we offer at CG Infinity: Salesforce Implementations, Customer Experience & CRM, Application Development & Integration, Production Support & QA, and Data Analytics & AI. Position Overview: CG Infinity is seeking a motivated and detail-orientParrish Security Group
Channelview, TX 77530 • (26 miles) • Full Time • 9/17/2026
Dispatcher- Must have verifiable experience in a security operations environment. Must demonstrate mastery of CCTV console operations. Must have a working knowledge of Lenel OnGuard software's System Administration Section. Must be able to type 40wpm.Actively hiring security officers to protect the facility’s assets, personnel, and operations from security threats. This includes patrolling the premises, controlling access, responding to incidents, and enforcing security protocols. You will also play a crucial role in maintaining a safe and secure environment by monitoring surveillance equipment, conducting inspections, and ensuring compliance with safety regulations.Responsibilities:Access Control - Monitoring and controlling the entry and exit of personnel, vehicles, and materials, prevenGFS Systems
Humble, TX 77396 • (14.6 miles) • Full Time • 9/17/2026
Fire Alarm/Portable Fire Extinguisher TechnicianAbout UsHouston Fire & Security is a highly respected full-service fire protection company that offers exceptional fire safety solutions for a diverse range of fire protection systems. We provide comprehensive services, including design, installation, repair, inspection, and maintenance, for commercial fire protection systems. With the ever-changing codes and regulations, we assist you in ensuring that your building complies with the latest standards. Whether it’s a mid-rise commercial or high-rise commercial building, we provide regularly scheduled fire protection inspections and maintenance to maintain the optimal functionality of your system.Job OverviewThis is a full-time on-site role for a Fire Alarm Technician based in Humble, TX. The FGuardian Safe & Lock LLC
Tomball, TX • (24.7 miles) • Full Time • 9/17/2026
Security Technician (Locksmith / Access Control / CCTV / Structured Cabling)Guardian Safe & Lock LLC – Houston, TX (Tomball Area)Guardian Safe & Lock LLC is one of the fastest-growing locksmith and security companies in the Houston metropolitan area. We specialize in access control, CCTV, and physical security integration, and we are looking for a motivated Security Technician to grow with us.This is not just a job, this is a long-term career opportunity with a company that is expanding year over year and building a strong, high-performing team.In this role, you will be responsible for installing, maintaining, troubleshooting, and repairing a wide range of security systems and related infrastructure. You will travel to residential, commercial, and industrial job sites performing a varietyCrescent Hotels & Resorts LLC
Houston, TX 77030 • (33.1 miles) • Full Time • 9/17/2026
A New Team. A New Vision. Endless Opportunities. Join The Blossom Today.The Loss Prevention / Security Officer is responsible for helping protect our guests, team members, property, and assets while maintaining the warm and professional atmosphere expected of a luxury hotel.This role conducts routine property patrols, monitors hotel areas for safety and security concerns, responds to incidents and guest or team member requests, and assists with emergency situations in accordance with hotel procedures. Responsibilities also include documenting incidents, monitoring access points, addressing suspicious activity, assisting with lost and found, and identifying potential safety or loss prevention concerns.The Loss Prevention / Security Officer works closely with Front Office, Housekeeping, EngiLantern Village Apartments
Houston, TX • (27.6 miles) • Full Time • 9/16/2026
One of the largest residential apartment communities in Southwest Houston is seeking a dependable, observant, and customer-service-oriented Unarmed Security Officer. In this role, you will maintain a safe, welcoming environment for residents and guests through active foot patrols, visitor logging, and clear daily communication.Key Responsibilities:Access Control & Visitor Logging: Greet residents and visitors, verify credentials, and maintain accurate visitor and vehicle logs at access points.Property Patrols: Perform routine, thorough foot patrols across property grounds, parking areas, and common amenities to deter unauthorized activity.Documentation & Reporting: Maintain detailed shift logs and draft clear, professional incident reports or daily correspondence.Resident Assistance & ServSENTRYSIX International
Houston, TX 77015 • (27.1 miles) • Full Time • 9/16/2026
*** THIS ANNOUNCEMENT MAY SERVE AS A CONTINUOUS ANNOUNCEMENT FOR ADDITIONAL VACANCIES FOR BOTH DAY AND NIGHT SHIFTS ***OverviewWe are seeking an Armed Security Specialist II to become an integral part of our team. In this position, you will be tasked to provide physical security, physical security inspections and entry access control at designated locations.A position with SENTRYSIX International is more than just a job, it’s the start of a great career. Joining the SENTRYSIX team means that you are joining an operational support and threat management provider to government and commercial clients worldwide. Because of this, we search for individuals of the highest caliber and experience.Veteran owned & operated company – Are you a Veteran? – We want to hear from you! APPLY TODAY!ResponsibiFirstOption Workforce Solutions
Houston, TX • (27.6 miles) • Full Time • 9/16/2026
Are you an experienced Alarm Installer/AV Technician looking for a great opportunity? Join a company that values your skills and offers steady, rewarding work! This role focuses oncustomresidentialhomes. Ready to take the next step in your career? Apply today and join a team that values your expertise!Responsibilities:Install access door hardware (some wire pulling involved).Read and interpret plans and blueprints with confidence.Work independently while collaborating with a supportive team.Troubleshoot complex system issues and implement effective solutions.Build strong relationships with customers by providing efficient and reliable service.Conduct site surveys to assess installation requirements.Stay up to date with training and team meetings.Take on additional tasks as needed.RequiremPegasus Preserve Of West University
Houston, TX 77005 • (32.8 miles) • Full Time • 9/16/2026
Do you have a passion to serve Seniors? More importantly, do you want to know that every day you are making a difference in a resident’s life in a senior living building? Then come join our team Human Resources Director!Great Place to Work Certified – come make it greater!! So many perks and programs!!Lead Security Guard/Partner Perks, Programs, and Benefits:Flexible Scheduling – In most cases, we can work our schedules to fit your schedule! (FT/PT)Same-Day pay options available (FT/PT)Competitive Benefits! Some highlights include: Medical (FT), Dental (FT), Vision (FT), 401K including matching (FT/PT), Employee Assistance (FT/PT) and much more!Generous PTO (FT)Holiday Pay (FT)Access to various Travel, Restaurant, and Retail Discounts through HR Partners (FT/PT)Unlimited employee referralCarvana
Houston, TX • (27.6 miles) • Full Time • 9/16/2026
Schedule (Open Availability Highly Preferred):Monday - Friday 8am-4:30amTuesday - Saturday 6am-2:30pmPay Range:$17 hourlyAbout CarvanaAt Carvana, we believe buying a car the old-fashioned way sucks so we're rewriting the playbook. Yes, we're the vending machine people. Yes, we built that on purpose. And yes, we're just getting started.We're looking for people who want tothrive in an environment of impactful change. Team spirit shows up in everything we do every day, our passion and creativity drive the kind of innovation that moves an industry. We take big swings, set ambitious goals, and challenge each other to make data- and process-driven decisions in everything we do. Here are a few of our stories. We've been changing the game since 2013, and we're not letting up. Want the full story?Alianza Security Professionals
Houston, TX 77079 • (35.2 miles) • Full Time • 9/16/2026
Unarmed Security Officer (Non-Commissioned)Alianza Security Professionals is hiring Security Officers to join our team. We are looking for reliable, punctual, and professional individuals to help us maintain a safe and secure environment for our clients.Available Positions:Part-TimeWhat We OfferStarting pay: $16/hr-$18/hrHealth Insurance + Vision/DentalLife Insurance401k MatchingWeekly PayBonuses and Holiday PayOpportunities for growth within the companyReferral BonusesRequirementsNo prior security experience required – we provide trainingStrong communication and professionalismDependable and punctualFluency and eloquence in Spanishpreferred (not required)About AlianzaSince 2018, Alianza has been committed to raising the standard of private security in Texas. We focus on professionalism, aFIRST CALL SECURITY INNOVATIONS LLC
Houston, TX 77032 • (15.2 miles) • Full Time • 9/15/2026
About the Role: First Call Security Innovations LLC is looking for a skilled Security Cable Installation Technician to join our growing team in Houston, TX. If you're passionate about hands-on technical work and want to play a key role in keeping businesses secure, this is the opportunity for you. Come build your career with a company that values craftsmanship, reliability, and cutting-edge security solutions. Responsibilities:Install, terminate, and test low-voltage security cabling including coax, Cat5e/Cat6, and fiber optic linesRun and route cables through walls, ceilings, conduit, and other structures in residential and commercial settingsMount and connect security cameras, access control panels, alarm systems, and related hardwareRead and interpret blueprints, wiring diagrams, and syVAM USA
Houston, TX 77073 • (15.6 miles) • Full Time • 9/15/2026
HSSE AdvisorMake An Impact With USThe HSSE Advisor will be a business representative for health, safety, security and environmental (HSSE) programs, ensuring compliance with Vallourec policies and standards, maintaining compliance with ISO Certification standards, and all local, state, and federal regulations. An HSSE Advisor is responsible for promoting a proactive HSSE culture and driving a continuous improvement-based HSSE management system. An HSSE Advisor will collaboration across business departments to align/standardize health, safety, security and environmental programs. An HSSE Advisor is responsible to support development of World Best in Class programs in HSSE Leadership, Management Systems and Culture to deliver on Vallourec’s ambitions for 2030 and beyond.Your Role at a GlancePure IT CUSO
Tomball, TX 77375 • (23.1 miles) • Full Time • 9/15/2026
About Us We’re a growing Managed Services Provider (MSP) dedicated to supporting credit unions with their IT and cybersecurity needs. Our mission is simple: keep our clients’ technology secure, reliable, and running smoothly so they can focus on serving their members. We value teamwork, curiosity, and innovation, and we believe that doing great work should also be fun. If you’re eager to build your cybersecurity career in a supportive, fast-growing environment, you’ll feel right at home here.The Position: The Security Analyst is an entry-level cybersecurity professional responsible for monitoring, analyzing, and supporting our client's organization’s security. This role focuses on operational security and works closely with outsourced Security Operations Centers (SOCs), internal InformatioRAE Security
Houston, TX 77064 • (25.7 miles) • Full Time • 9/15/2026
Alarm TechnicianHouston, TXDescription Alarm TechnicianReports to Operations TeamAn alarm technician is responsible for installing, maintaining, and repairing fire and security alarm systems in homes and businesses.Core Values:Be Respectful, Be Accountable, Be ExceptionalWe Offer:- Competitive pay- Great benefits package- Excellent growth opportunitiesLocation: Houston, TXPosition Summary: This is a great opportunity for applicants with strong alarm security installation and service skills who want to provide excellent customer satisfaction services.Job Requirements-- To be able to install and service commercial alarm systems- install alarm devices and accessories- program alarm systems- train customers on alarm systems- Testing systems to ensure proper functionality- Diagnosing and repairWILSON FIRE EQUIPMENT & SERVICE CO INC
Houston, TX 77040 • (27.1 miles) • Full Time • 9/15/2026
Description: Objective:Installation Helper to assist in the installation, maintenance, and servicing of fire alarm systems. The ideal candidate will have a basic understanding of electrical systems, excellent attention to detail, and a strong willingness to learn and grow within the field. This role provides hands-on experience in the fire safety industry while working alongside experienced technicians.ResponsibilitiesAssist in the installation and maintenance of low voltage systems.Help troubleshoot and repair low voltage systems and components.Work with the technician to test and inspect low voltage systems for proper operation.Support the setup and wiring of low voltage equipment, including control panels, and devices.Handle tools, equipment, and materials related to low voltage systemsIEvolve Technology, Llc
Houston, TX 77008 • (27.6 miles) • Full Time • 9/15/2026
Benefits:Company carCompetitive salaryDental insuranceEmployee discountsHealth insuranceOpportunity for advancementPaid time offAudio/Video & Security Installation TechnicianiEvolve Technology LLC Location: Greater Houston Area, TX Job Type: Full-Time Compensation: Based on Experience About Us iEvolve Technology is a growing technology integration company specializing in residential and commercial security systems, surveillance cameras, access control, audio/video solutions, and smart home automation. We are committed to delivering exceptional customer experiences and high-quality installations. We are seeking a motivated, dependable, and technically skilled Installation Technician to join our team. Position Summary The Audio/Video & Security Installation Technician is responsible for instWaveStrong, Inc.
Houston, TX • (27.6 miles) • Full Time • 9/15/2026
Exciting Security / Soc Analyst III, 6 months contract opportunity in Houston, TX.Requirements5 plus years experience in the security domain, Incident Response, threat monitoring, and handling incidents (incident triage and response)Determine detection requirements for data sources being on-boarded to the SIEM, and assessing the value of in place SIEM detection cases, in order to determine gaps and overlap in the overall detection scheme.Perform security monitoring and incident response of cyber security events for proper determination of being considered a cybersecurity event.Triage offenses for false positivesHands-on experience defining detection or protection schemes based on industry standards and frameworks.SIEM, Endpoint Detection and Response, Firewall/IPS/IDS, Proxy, Data Loss PreAddison Group
Houston, TX • (27.6 miles) • Full Time • 9/15/2026
Job Title: Applications Security AdministratorLocation: Houston, TX Employment Type: Full-Time | Exempt100k-150kBenefits: This position is eligible for medical, dental, vision, 401(k), disability leave, bonus program, and PTO.About the Role:We are seeking an experienced Applications Security Administrator to join our IT team. In this role, you will be responsible for securing enterprise applications, managing user access, and supporting audit and compliance activities. You’ll play a key role in implementing and maintaining identity and access management tools, with a strong focus on SOX compliance, enterprise security tools, and application security best practices.Key Responsibilities:Security Management:Administer and monitor user access across enterprise applications and systemsLead andThe Forum At Memorial Woods
Houston, TX • (27.6 miles) • Full Time • 9/15/2026
**Job Title: PRN Security Officer - Independent & Assisted Living Facility****Job Description:**We are seeking a dedicated and professional PRN Security Officer to join our team at our Independent and Assisted Living Facility. This position requires a reliable individual who is committed to maintaining the safety and security of our residents and staff, and who can work on an as-needed basis to support our facility’s operations.**Key Responsibilities:**- Monitor and patrol assigned areas to provide a safe and secure environment for residents, staff, and visitors. - Respond swiftly to emergency situations, ensuring the appropriate procedures are followed to maintain safety. - Report any suspicious activities, safety hazards, or other security concerns to management immediately. - Operate suMetroNational
Houston, TX 77024 • (32 miles) • Full Time • 9/15/2026
Description: ***MUST HAVE a VAID TEXAS DRIVERS LICENSE with NO RESTRICTIONS***MUST BE ABLE TO WORK ALL SHIFTS as ASSIGNED***Everything we do at MetroNational comes back to our purpose: To Build Better Lives. It’s our North Star and the reason we do the work we do. As a MetroNational Security Ambassador I, you build better lives by forming bonds with our guests, tenants, and residents, developing relationships with them, and ensuring a safe environment on our beautiful campus in Memorial City.As a Security Ambassador I, you may work in an office building, across our campus grounds/garages, a mall, or even a hospital. You may patrol on foot, cart, or bike, depending upon your interest and experience. We believe in providing exceptional service every day and ask that you go above and beyond tLucky Strike Entertainment
Houston, TX 77024 • (32 miles) • Full Time • 9/15/2026
OverviewYour next adventure starts here! At Lucky Strike Entertainment, great times and exciting opportunities go hand in hand. Join us as a Security Officer and become part of a vibrant atmosphere filled with dynamic experiences and endless possibilities. Start making your own luck today!Applicants must be at least 18 years of age to qualify for a position.WHAT OUR SECURITY OFFICERS DOSecurity Officers help to ensure our guests have a safe and enjoyable experience to remember. A SECURITY OFFICER’S DAY-TO-DAYGreet guests in a friendly and inviting mannerCheck guest identification when age restrictions are enforcedEnsure guests adhere to the venue’s safety policies and proceduresAssists with monitoring alcohol service security functions, including guest serving limitsDiffuses difficult guesS.A.F.E. MANAGEMENT
Houston, TX 77054 • (34.7 miles) • Full Time • 9/15/2026
Now Hiring Event Staff at NRG Park!Company DescriptionS.A.F.E. (Security, Athletic Facilities & Events) Management is specifically tailored guest services, security, crowd management and parking staffing company that specializes in sport facility, special event management and 24/7 facility security.Description:S.A.F.E. Management is currently hiring! Are you looking for a part-time job where you can make your own schedule? Do you thrive working in a fast-paced exciting atmosphere and enjoy sporting events and concerts? S.A.F.E. Management is currently hiring part-time Event Staff Team Members to work at - NRG Park in Houston, TX!Summary ? Part-Time Event StaffS.A.F.E. Management's team members enjoy working sporting events, concerts, and other events. We strive to be friendly & considerateProTech Fire And Security
Houston, TX • (27.6 miles) • Full Time • 9/15/2026
The Senior Project Manager for Commercial Fire Alarm and Security Installs will oversee medium-sized project teams, typically consisting of 6-15 members, ensuring the successful delivery of installation projects for fire alarm and security systems. Reporting to Senior Management, this role requires frequent travel to job sites to maintain direct oversight and client engagement. The ideal candidate will combine strong project management skills with industry-specific knowledge to coordinate teams, manage budgets, and uphold safety and quality standards.ResponsibilitiesPlan and schedule project activities to ensure timely completionCoordinate and lead project teams to achieve objectivesMaintain effective communication with clients and stakeholdersManage project budgets and control costsEnsureDatasmart/Duncan Security LLC
Houston, TX • (27.6 miles) • Full Time • 9/15/2026
Job Summary: This position is responsible for the installation and activation of monitored security systems through the Company. Is responsible for trouble shooting and repairing these systems when needed. It also helps with other low voltage/AV/network installations of products purchased by the customer.Responsibilities:Basic alarm panel programming.· Basic networking knowledge from router set up, terminating all fittings (Cat 5, Cat 6, R66, BNC, etc.) and inserts.· Speaker installs and volume controls.· Able to find cables or tone cables in walls.· Assists with television hangs.· Able to install WI-FI packages.· Activations for Alarm.com and Total Connect.· Able to install cameras and DVRs.· Knowledge of security panels.· Television hangs without help.· Able to hook up audio/amps.· ProjeFirst Response Solution LLC
Houston, TX • (27.6 miles) • Full Time • 9/15/2026
First Response Solution - Security Officer (Commissioned/Non-Commissioned)Position Type: Part and Full TimePay Rate: starting pay at $12/hour (DOE)At First Response Solution, we are committed to delivering unparalleled security services rooted in integrity, professionalism, and real-world expertise. We are seeking dedicated, motivated Security Officers to join our team and help us protect our clients' assets and ensure the safety of their personnel.Responsibilities:Patrol and monitor assigned posts to prevent and detect security breaches.Enforce client-specific rules and regulations, as well as company policies and procedures.Conduct regular checks of assigned areas to ensure safety and security.Respond to alarms, emergencies, and other security incidents, providing assistance and maintainLocke Protective Services
Houston, TX • (27.6 miles) • Full Time • 9/11/2026
HIRING NOW!!!We are seeking a Security Officers (Commissioned and Non-Commissioned) and Response Officers to become an integral part of our team. The selected individual will patrol and secure assigned premises as well as identify risks to staff and patrons.Qualifications:Must have reliable transportationMust have TX Driver's License & SS CardMust have working phoneMust be at least 21 years of ageMust have a clear criminal backgroundPay Rate: $18.00 Benefits include Weekly Pay, Holiday Pay, Direct Deposit, Company paid uniforms, Paid Vacations, 401K Plan, and Medical and Dental Plans. Officer of the Quarter AwardMust apply in person at: 1616 S. Voss, Houston, TX 77057, Suite #250 Monday-Friday 8:30 am to 3:30 pm.\nCompany DescriptionIn business since 1994, Locke Protective Services is theState Fire
Houston, TX 77001 • (30.1 miles) • Full Time • 9/11/2026
Description: Join a company where your reliability and craftsmanship are valued. State Fire is seeking an experienced, licensed Fire Alarm Technician to join our growing team in the Houston, TX region. As a regional leader in fire protection, we specialize in the installation, service, and maintenance of fire alarm systems, alarm monitoring, special hazard suppression systems, fire sprinklers, security systems, and more.We’re looking for a dependable professional who takes pride in doing the job right, someone with strong technical ability, a solid work ethic, and a commitment to quality and safety. If you want to build a long-term career with a company that values expertise and reliability, we want to hear from you.What You’ll Do Install, inspect, service, and maintain a variety of fire aEvergreen Fire And Security
Houston, TX 77001 • (30.1 miles) • Full Time • 9/11/2026
Who We AreEvergreen Fire and Security (EFS) is a recognized leader in the life safety and security solutions industry. We are entrusted by the Federal Government and commercial customers to protect lives, critical infrastructure, and information by providing and maintaining technically advanced and innovative fire alarm, access control, intrusion detection, CCTV, mass notification, and other critical protection systems.The Key to Our SuccessOur success is largely due to the experience, skills, and expertise of the best and brightest employees in the industry. Due to growth, we are looking for additional qualified experts to join the Evergreen team. Think you have what it takes? Great! We welcome you to submit your qualifications for this great Evergreen Fire and Security career opportunityTRI SHIELD SECURITY & INVESTIGATIONS LLC
Houston, TX • (27.6 miles) • Full Time • 9/10/2026
SECURITY OFFICERS - NON AND COMMISSIONEDTri Shield Security & Investigations Currently has an opening for a Full time Commission Security Officers to serve in the Houston area and must have level lll card in hand.*******************************************************************************************************We are seeking Experienced Security Officers with a positive attitude, customer service experience, great work ethics, and those who can work alone as well as with others. The ideal Security Officer is safety focused, an effective communicator, detail oriented, and ready to serve and protect the public and our clients.Position Details:(Full-time Level 3 Commissioned)Candidates with Criminal Justice, military, police, and Commissioned security experience are encouraged to apply.SEAbsolutesf LLC- Absolute Security Force LLC
Houston, TX 77003 • (29.1 miles) • Full Time • 9/10/2026
Benefits/PerksCareer Advancement OpportunitiesCompetitive CompensationFlexible ScheduleJob Summary We are seeking a professional Security Guard to join our team. In this role, your primary responsibility will be to create a safe and secure environment. You will protect our premises, assets, and employees and prevent any illegal or inappropriate occurrences. The ideal candidate has experience with public safety and security and operates with a high degree of integrity at all times. ResponsibilitiesPatrol the premises and maintain a high level of visibilityMonitor entrances and exits to ensure only authorized personnel access the facilityRemove trespassers when necessaryMonitor surveillance camerasRespond to reports of suspicious activityReport on daily activities and any security incidentsQPegasus Preserve Of Memorial City
Houston, TX 77024 • (32 miles) • Full Time • 9/10/2026
Do you have a passion to serve Seniors? More importantly, do you want to know that every day you are making a difference in a resident’s life in a senior living building? Then come join our team Human Resources Director!Great Place to Work Certified – come make it greater!! So many perks and programs!!Lead Security Guard/Partner Perks, Programs, and Benefits:Flexible Scheduling – In most cases, we can work our schedules to fit your schedule! (FT/PT)Same-Day pay options available (FT/PT)Competitive Benefits! Some highlights include: Medical (FT), Dental (FT), Vision (FT), 401K including matching (FT/PT), Employee Assistance (FT/PT) and much more!Up to 20 days per year of PTO (FT)Access to various Travel, Restaurant, and Retail Discounts through HR Partners (FT/PT)Unlimited employee referralGoldfish Swim School - Houston Heights
Houston, TX 77008 • (27.6 miles) • Full Time • 9/10/2026
Benefits:Free uniformsOpportunity for advancementTraining & developmentFlexible scheduleSaving and changing lives, every single day. We have a mission to teach kids how to swim and be safer, in and around the water, while making their experience GOLDEN! Working for Goldfish Swim School will allow you to provide children and families with necessary life skills to combat the ever-growing drowning statistics. Whether you are in the pool leading instruction for our swimmers or warmly greeting our members in our tropical lobby as a front desk representative, you are making an impact. Perks and Benefits:Paid on-the-job trainingFlexible schedulingCulture driven companyEmployee recognition programsPrimary Responsibilities:Keep swimmers safe with lifeguard supervisionProvide any first aid necessaryExecutive Security Integrators & Fi
Channelview, TX 77530 • (26 miles) • Full Time • 9/9/2026
Benefits:401(k)401(k) matchingCompetitive salaryDental insuranceFree uniformsHealth insuranceOpportunity for advancementPaid time offTraining & developmentVision insurancePosition Summary: The standard function of the position is to build, program, deploy, and service our Mobile Security Trailers (MSTs). The position requires that the candidate is able to adjust to a fast-paced market where last-minute movements happen often. The candidate will need to be able to work with minimal supervision and provide great customer service. Duties And ResponsibilitiesInstall and service CCTV, batteries, solar panels, and solar controls.Maintain and service small engine gas powered generators.Must have a strong work ethic and ability to work well with other team members.Provides reliable, high quality cUnited Service Company
Houston, TX 77002 • (29.1 miles) • Full Time • 9/9/2026
Hotel Security Officer-FT United Security Services, Inc., a national security company, is seeking a professional full-time overnight Security Officer for an upscale hotel in the Downtown Houston area.Security Officer Position Requirements:At least 2 years of public safety or private security experience.Have excellent customer service skills and sound judgement.Schedule adherence and punctuality.Must be proficient with interacting, communicating and working jointly with a hotel staff.Must possess, or can acquire by time of employment, a Level II noncommissioned Texas Security Officer license.Must have the availability and flexible to work any day, including weekends and holidays, and any work shift based on the operational needs of the hotel.Must be able to climb stairs, stand, walk for lonPreferred Technologies, LLC
Houston, TX 77093 • (21.7 miles) • Full Time • 9/9/2026
Why Pref-Tech?Voted "Top Workplaces" by Houston Chronicle and Austin American Statesman, 2 years in a row! We aim to make “family” a core reason we attract incredible people, retain them, and collectively deliver unequaled quality and service to customers. If your heart and mind are pushing you to join a team who deeply desires to be the best in the world, has a long-game approach to business, prides itself on doing exceptional work, celebrates service to others, and is willing to invest in you, you should consider Pref-Tech.Position Overview: This role is in Corpus Christi for an O&G facility. The Security Technician 2 at Pref-Tech will be responsible for installing access control, IP-based and analog video management systems, intrusion, and auto-gate equipment. Scope of duties include, bThompson Safety, LLC
Houston, TX 77066 • (22.2 miles) • Full Time • 9/9/2026
Job Summary:The Fire Alarm Technicianis responsible forthe installation, testing, inspection, service, and repair of fire alarm systems. Respond to emergency and maintenance calls and troubleshoot/replace faulty devices to restore alarm panels to “normal condition”.Complete inspection and service reports.Supervisory Responsibilities:NoneEssential Job Functions:Traveltocustomerlocationstoperforminstallation,service,andupgradesoffirealarmsystems.Respondtoemergencysituationsduringandafterbusinesshourstoresolvesafetyconcerns.PerformAnnualandSemi-annualinspectionofLifeSafetySystems.Write and provide inspection/service reports on tested equipment and devices.Indicate any deficiencies or corrections that need tobemade.TroubleshootanddiagnosefaultsormalfunctionsinfirealarmsystemsandtakeappropriateDigi Security Systems
Houston, TX • (27.6 miles) • Full Time • 9/9/2026
Digi Security Systems is an industry leader in the design, installation and support of custom video surveillance, electronic access control, and intrusion detection solutions for public and private partners. We've built our reputation on innovation and reliable service, and we're known as the industry's experts.Position OverviewDigi Security Systems is seeking an experienced low voltage Project Manager to oversee the planning and execution of high-level commercial security systems projects. A PMP certification (or equivalent project management certification) required.This role involves managing teams responsible for installation, service, troubleshooting, and programming of systems including video surveillance, electronic access control, and intrusion detection. Preference will be given to