Houston, TX • (40 miles) • Full Time • 9/14/2026

Job Summary: This position is responsible for the installation and activation of monitored security systems through the Company. Is responsible for trouble shooting and repairing these systems when needed. It also helps with other low voltage/AV/network installations of products purchased by the customer.Responsibilities:Basic alarm panel programming.· Basic networking knowledge from router set up, terminating all fittings (Cat 5, Cat 6, R66, BNC, etc.) and inserts.· Speaker installs and volume controls.· Able to find cables or tone cables in walls.· Assists with television hangs.· Able to install WI-FI packages.· Activations for Alarm.com and Total Connect.· Able to install cameras and DVRs.· Knowledge of security panels.· Television hangs without help.· Able to hook up audio/amps.· Proje

Houston, TX • (40 miles) • Full Time • 9/13/2026

First Response Solution - Security Officer (Commissioned/Non-Commissioned)Position Type: Part and Full TimePay Rate: starting pay at $12/hour (DOE)At First Response Solution, we are committed to delivering unparalleled security services rooted in integrity, professionalism, and real-world expertise. We are seeking dedicated, motivated Security Officers to join our team and help us protect our clients' assets and ensure the safety of their personnel.Responsibilities:Patrol and monitor assigned posts to prevent and detect security breaches.Enforce client-specific rules and regulations, as well as company policies and procedures.Conduct regular checks of assigned areas to ensure safety and security.Respond to alarms, emergencies, and other security incidents, providing assistance and maintain

Houston, TX • (40 miles) • Full Time • 9/11/2026

The Senior Project Manager for Commercial Fire Alarm and Security Installs will oversee medium-sized project teams, typically consisting of 6-15 members, ensuring the successful delivery of installation projects for fire alarm and security systems. Reporting to Senior Management, this role requires frequent travel to job sites to maintain direct oversight and client engagement. The ideal candidate will combine strong project management skills with industry-specific knowledge to coordinate teams, manage budgets, and uphold safety and quality standards.ResponsibilitiesPlan and schedule project activities to ensure timely completionCoordinate and lead project teams to achieve objectivesMaintain effective communication with clients and stakeholdersManage project budgets and control costsEnsure

Houston, TX • (40 miles) • Full Time • 9/11/2026

HIRING NOW!!!We are seeking a Security Officers (Commissioned and Non-Commissioned) and Response Officers to become an integral part of our team. The selected individual will patrol and secure assigned premises as well as identify risks to staff and patrons.Qualifications:Must have reliable transportationMust have TX Driver's License & SS CardMust have working phoneMust be at least 21 years of ageMust have a clear criminal backgroundPay Rate: $18.00 Benefits include Weekly Pay, Holiday Pay, Direct Deposit, Company paid uniforms, Paid Vacations, 401K Plan, and Medical and Dental Plans. Officer of the Quarter AwardMust apply in person at: 1616 S. Voss, Houston, TX 77057, Suite #250 Monday-Friday 8:30 am to 3:30 pm.\nCompany DescriptionIn business since 1994, Locke Protective Services is the

Houston, TX • (40 miles) • Full Time • 9/5/2026

Join Our Security Team!Are you looking for a stable, rewarding job with growth opportunities? We’re hiring dedicated security professionals! Here’s what we offer:What We Offer:- Set schedules available – Day, swing, and overnight shifts based upon availability.- 90-Day Raise and Performance Bonuses– Start building your career and earning more, fast.- Growth Opportunities– We promote from within for those ready to take the next step!Requirements:- Must Pass a Drug Test – This is a non-negotiable requirement.- Experience & Knowledge – Prior security experience is a plus, but we’re willing to train the right candidates.- Credentials – You must possess:- A valid Texas ID or Driver’s License.- A valid Social Security Card.- A current Non-Commission Security Guard License (Certificates are not a

Houston, TX 77001 • (34 miles) • Full Time • 9/3/2026

We are seeking Armed Security Officers to provide mobile escort services for client personnel as they travel to and from work locations and while performing sensitive on-site tasks. This is an on-call position that requires flexibility and professionalism. Officers do not handle or transport valuables the role is strictly focused on protecting people and ensuring a safe working environment.ResponsibilitiesEscort and safeguard client personnel during travel and onsite assignments.Provide a visible armed presence to deter threats while clients perform tasks.Remain alert to potential risks and respond appropriately to incidents.Maintain professional communication with dispatch, supervisors, and client personnel.Complete accurate daily activity and incident reports.Follow all company policies,

Houston, TX • (40 miles) • Full Time • 9/2/2026

Are you passionate about protecting organizations from cyber threats and helping shape the future of cybersecurity? Virtuo Group is seeking a skilled and motivated Cybersecurity Analyst to join our award-winning team. In this role, you’ll monitor, detect, and respond to security incidents, while working alongside experts who are dedicated to keeping our clients’ systems secure. If you thrive in a fast-paced, dynamic environment and enjoy solving complex challenges, this is the opportunity to make a real impact.Workdays & Hours: MONDAY – FRIDAY 8:00 AM – 5:00 PM* *Subject to Change / Remote is Not an OptionDESCRIPTION OF DUTIES / ESSENTIAL FUNCTIONSDuties, functions and responsibilities of this position include:Responsible for communicating cyber risks and recommendations to mitigate risks

Houston, TX • (40 miles) • Full Time • 9/2/2026

Job DescriptionWe are seeking a reliable and professional Security Guard to protect people, property, and facilities. The Security Guard will monitor assigned areas, conduct foot or vehicle patrols, control access, respond to security incidents, and maintain a safe environment.ResponsibilitiesPatrol and monitor assigned buildings, property, and parking areas.Monitor cameras, alarms, entrances, and access points.Check IDs, visitors, and vehicles as required.Prevent and report theft, vandalism, trespassing, and suspicious activity.Respond to alarms, emergencies, and security incidents.Maintain daily activity and incident reports.Communicate with supervisors, employees, visitors, and emergency personnel.Follow company security policies and site procedures.Armed Guards: Carry and handle an aut

Cleveland, TX • (27.6 miles) • Full Time • 8/25/2026

We are seeking a Security Officerto become an integral part of our team. The selected individual will patrol and secure assigned premisesas well as identify risks to staff and patrons.Responsibilities:Monitor premises to prevent theft, violence, or infractions of rulesThoroughly examinedoors, windows, and gates to ensure proper function and securityWarnviolators of premise rules and regulationsApprehendor expelpersons engaging in suspicious or criminal actsReport anyfacility issues such as fire hazards andleaking water pipesRequest emergency personnel for high risk situationsQualifications:Previous experience in security, law enforcement,or other related fieldsFamiliarity with security equipmentAbility to handle physical workloadStrong attention to detail

Houston, TX • (40 miles) • Full Time • 8/21/2026

We are seeking a Commissioned Security Officerto become an integral part of our team. The selected individual will patrol and secure assigned premisesas well as identify risks to staff and patrons.Responsibilities:Monitor premises to prevent theft, violence, or infractions of rulesThoroughly examinedoors, windows, and gates to ensure proper function and securityWarnviolators of premise rules and regulationsApprehendor expelpersons engaging in suspicious or criminal actsReport anyfacility issues such as fire hazardsRequest emergency personnel for high risk situationsQualifications:Previous experience in security, law enforcement,or other related fieldsFamiliarity with security equipmentAbility to handle physical workloadStrong attention to detail\nCompany DescriptionIn Service Security LLCC

Channelview, TX 77530 • (25.9 miles) • Full Time • 8/20/2026

Dispatcher- Must have verifiable experience in a security operations environment. Must demonstrate mastery of CCTV console operations. Must have a working knowledge of Lenel OnGuard software's System Administration Section. Must be able to type 40wpm.Actively hiring security officers to protect the facility’s assets, personnel, and operations from security threats. This includes patrolling the premises, controlling access, responding to incidents, and enforcing security protocols. You will also play a crucial role in maintaining a safe and secure environment by monitoring surveillance equipment, conducting inspections, and ensuring compliance with safety regulations.Responsibilities:Access Control - Monitoring and controlling the entry and exit of personnel, vehicles, and materials, preven

Houston, TX • (40 miles) • Full Time • 8/19/2026

One of the largest residential apartment communities in Southwest Houston is seeking a dependable, observant, and customer-service-oriented Unarmed Security Officer. In this role, you will maintain a safe, welcoming environment for residents and guests through active foot patrols, visitor logging, and clear daily communication.Key Responsibilities:Access Control & Visitor Logging: Greet residents and visitors, verify credentials, and maintain accurate visitor and vehicle logs at access points.Property Patrols: Perform routine, thorough foot patrols across property grounds, parking areas, and common amenities to deter unauthorized activity.Documentation & Reporting: Maintain detailed shift logs and draft clear, professional incident reports or daily correspondence.Resident Assistance & Serv

Houston, TX 77073 • (36.6 miles) • Full Time • 9/13/2026

HSSE AdvisorMake An Impact With USThe HSSE Advisor will be a business representative for health, safety, security and environmental (HSSE) programs, ensuring compliance with Vallourec policies and standards, maintaining compliance with ISO Certification standards, and all local, state, and federal regulations. An HSSE Advisor is responsible for promoting a proactive HSSE culture and driving a continuous improvement-based HSSE management system. An HSSE Advisor will collaboration across business departments to align/standardize health, safety, security and environmental programs. An HSSE Advisor is responsible to support development of World Best in Class programs in HSSE Leadership, Management Systems and Culture to deliver on Vallourec’s ambitions for 2030 and beyond.Your Role at a Glance

Houston, TX • (40 miles) • Full Time • 9/12/2026

Exciting Security / Soc Analyst III, 6 months contract opportunity in Houston, TX.Requirements5 plus years experience in the security domain, Incident Response, threat monitoring, and handling incidents (incident triage and response)Determine detection requirements for data sources being on-boarded to the SIEM, and assessing the value of in place SIEM detection cases, in order to determine gaps and overlap in the overall detection scheme.Perform security monitoring and incident response of cyber security events for proper determination of being considered a cybersecurity event.Triage offenses for false positivesHands-on experience defining detection or protection schemes based on industry standards and frameworks.SIEM, Endpoint Detection and Response, Firewall/IPS/IDS, Proxy, Data Loss Pre

Houston, TX • (40 miles) • Full Time • 9/11/2026

Role:As a Cybersecurity Analyst, you will protect the Credit Union's information assets, systems, and member data through proactive monitoring, risk management, incident response, security governance, and continuous improvement activities. The position supports cybersecurity operations, regulatory compliance, vendor risk management, and cyber resilience initiatives aligned with NIST Cybersecurity Framework (CSF), CIS Controls, FFIEC guidance, and NCUA expectations. The Cybersecurity Analyst partners with technology and business teams to integrate security into all business processes and technology solutionsEssential Functions & Responsibilities:Monitor and investigate security events, alerts, and anomalous activity. Analyze threats using SIEM, EDR, NGAV, and threat intelligence sources. Pa

Houston, TX 77001 • (34 miles) • Full Time • 9/11/2026

Description: Join a company where your reliability and craftsmanship are valued. State Fire is seeking an experienced, licensed Fire Alarm Technician to join our growing team in the Houston, TX region. As a regional leader in fire protection, we specialize in the installation, service, and maintenance of fire alarm systems, alarm monitoring, special hazard suppression systems, fire sprinklers, security systems, and more.We’re looking for a dependable professional who takes pride in doing the job right, someone with strong technical ability, a solid work ethic, and a commitment to quality and safety. If you want to build a long-term career with a company that values expertise and reliability, we want to hear from you.What You’ll Do Install, inspect, service, and maintain a variety of fire a

Houston, TX 77001 • (34 miles) • Full Time • 9/11/2026

Who We AreEvergreen Fire and Security (EFS) is a recognized leader in the life safety and security solutions industry. We are entrusted by the Federal Government and commercial customers to protect lives, critical infrastructure, and information by providing and maintaining technically advanced and innovative fire alarm, access control, intrusion detection, CCTV, mass notification, and other critical protection systems.The Key to Our SuccessOur success is largely due to the experience, skills, and expertise of the best and brightest employees in the industry. Due to growth, we are looking for additional qualified experts to join the Evergreen team. Think you have what it takes? Great! We welcome you to submit your qualifications for this great Evergreen Fire and Security career opportunity

Beaumont, TX 77705 • (38.1 miles) • Full Time • 9/10/2026

Qualifications•Be at least 18 years of age for unarmed roles; 21+ years of age for armed roles•Possess a high school diploma or equivalent, or 5 years of verifiable experience•As a condition of employment, applicants will be subject to a background investigation in accordance with all federal, state, and local laws•As a condition of employment, applicants will be subject to a drug screen to the extent permitted by law•Licensing requirements are subject to state and/or local laws and regulations and may be required prior to employment•A valid driver's license will be required for driving positions onlyResponsibilities•Provide customer service to our clients by carrying out safety and security procedures, site-specific policies and when appropriate, emergency response activities•Respond to i

Houston, TX 77003 • (38.9 miles) • Full Time • 9/10/2026

Benefits/PerksCareer Advancement OpportunitiesCompetitive CompensationFlexible ScheduleJob Summary We are seeking a professional Security Guard to join our team. In this role, your primary responsibility will be to create a safe and secure environment. You will protect our premises, assets, and employees and prevent any illegal or inappropriate occurrences. The ideal candidate has experience with public safety and security and operates with a high degree of integrity at all times. ResponsibilitiesPatrol the premises and maintain a high level of visibilityMonitor entrances and exits to ensure only authorized personnel access the facilityRemove trespassers when necessaryMonitor surveillance camerasRespond to reports of suspicious activityReport on daily activities and any security incidentsQ

Houston, TX • (40 miles) • Full Time • 9/10/2026

SECURITY OFFICERS - NON AND COMMISSIONEDTri Shield Security & Investigations Currently has an opening for a Full time Commission Security Officers to serve in the Houston area and must have level lll card in hand.*******************************************************************************************************We are seeking Experienced Security Officers with a positive attitude, customer service experience, great work ethics, and those who can work alone as well as with others. The ideal Security Officer is safety focused, an effective communicator, detail oriented, and ready to serve and protect the public and our clients.Position Details:(Full-time Level 3 Commissioned)Candidates with Criminal Justice, military, police, and Commissioned security experience are encouraged to apply.SE

Beaumont, TX • (38.6 miles) • Full Time • 9/10/2026

Join Firetrol Protection Systems as a Security Technician!At Firetrol Protection Systems, we specialize in providing premier fire protection and security services across the nation. With over 35 years of industry experience, we take pride in our commitment to quality and excellence. We are looking for dedicated Security Technicians to enhance our team and support our clients in maintaining secure environments.RequirementsProven experience in installing, maintaining, and troubleshooting security and surveillance systems.In-depth knowledge of access control systems, CCTV systems, and alarm systems.Ability to read and interpret system schematics and installation manuals.Effective communication skills to liaise with clients and team members.Strong problem-solving skills and attention to detail

Houston, TX 77008 • (41.2 miles) • Full Time • 9/10/2026

Benefits:Free uniformsOpportunity for advancementTraining & developmentFlexible scheduleSaving and changing lives, every single day. We have a mission to teach kids how to swim and be safer, in and around the water, while making their experience GOLDEN! Working for Goldfish Swim School will allow you to provide children and families with necessary life skills to combat the ever-growing drowning statistics. Whether you are in the pool leading instruction for our swimmers or warmly greeting our members in our tropical lobby as a front desk representative, you are making an impact. Perks and Benefits:Paid on-the-job trainingFlexible schedulingCulture driven companyEmployee recognition programsPrimary Responsibilities:Keep swimmers safe with lifeguard supervisionProvide any first aid necessary

Houston, TX 77040-3207 • (40 miles) • Full Time • 9/9/2026

Description: Objective: Sell security system solutions that meet customer expectations and comply with job specifications and current applicable codes. Knowledge of electronic security systems required to prepare project bids and proposals.Job Description:· Estimate projects and provide quotations to new and existing customers.· Review specifications for each project and bid accordingly.· Manage existing accounts and make sales calls on new customers consistently.· Generate and maintain relationships with Engineers and Industry Consultants.· Provide information to all departments as required.· Review progress of jobs.· Attend job turnover and project meetings.· Follow up with customer during and after project.· Estimate and follow up on change orders.· Maintain Sales Quote Logs and Bid Cal

Channelview, TX 77530 • (25.9 miles) • Full Time • 9/9/2026

Benefits:401(k)401(k) matchingCompetitive salaryDental insuranceFree uniformsHealth insuranceOpportunity for advancementPaid time offTraining & developmentVision insurancePosition Summary: The standard function of the position is to build, program, deploy, and service our Mobile Security Trailers (MSTs). The position requires that the candidate is able to adjust to a fast-paced market where last-minute movements happen often. The candidate will need to be able to work with minimal supervision and provide great customer service. Duties And ResponsibilitiesInstall and service CCTV, batteries, solar panels, and solar controls.Maintain and service small engine gas powered generators.Must have a strong work ethic and ability to work well with other team members.Provides reliable, high quality c

Houston, TX 77002 • (39.7 miles) • Full Time • 9/9/2026

Hotel Security Officer-FT United Security Services, Inc., a national security company, is seeking a professional full-time overnight Security Officer for an upscale hotel in the Downtown Houston area.Security Officer Position Requirements:At least 2 years of public safety or private security experience.Have excellent customer service skills and sound judgement.Schedule adherence and punctuality.Must be proficient with interacting, communicating and working jointly with a hotel staff.Must possess, or can acquire by time of employment, a Level II noncommissioned Texas Security Officer license.Must have the availability and flexible to work any day, including weekends and holidays, and any work shift based on the operational needs of the hotel.Must be able to climb stairs, stand, walk for lon

Houston, TX 77093 • (35.3 miles) • Full Time • 9/9/2026

Why Pref-Tech?Voted "Top Workplaces" by Houston Chronicle and Austin American Statesman, 2 years in a row! We aim to make “family” a core reason we attract incredible people, retain them, and collectively deliver unequaled quality and service to customers. If your heart and mind are pushing you to join a team who deeply desires to be the best in the world, has a long-game approach to business, prides itself on doing exceptional work, celebrates service to others, and is willing to invest in you, you should consider Pref-Tech.Position Overview: This role is in Corpus Christi for an O&G facility. The Security Technician 2 at Pref-Tech will be responsible for installing access control, IP-based and analog video management systems, intrusion, and auto-gate equipment. Scope of duties include, b

Houston, TX • (40 miles) • Full Time • 9/9/2026

Digi Security Systems is an industry leader in the design, installation and support of custom video surveillance, electronic access control, and intrusion detection solutions for public and private partners. We've built our reputation on innovation and reliable service, and we're known as the industry's experts.Position OverviewDigi Security Systems is seeking an experienced low voltage Project Manager to oversee the planning and execution of high-level commercial security systems projects. A PMP certification (or equivalent project management certification) required.This role involves managing teams responsible for installation, service, troubleshooting, and programming of systems including video surveillance, electronic access control, and intrusion detection. Preference will be given to

Houston, TX 77066 • (43.1 miles) • Full Time • 9/9/2026

Job Summary:The Fire Alarm Technicianis responsible forthe installation, testing, inspection, service, and repair of fire alarm systems. Respond to emergency and maintenance calls and troubleshoot/replace faulty devices to restore alarm panels to “normal condition”.Complete inspection and service reports.Supervisory Responsibilities:NoneEssential Job Functions:Traveltocustomerlocationstoperforminstallation,service,andupgradesoffirealarmsystems.Respondtoemergencysituationsduringandafterbusinesshourstoresolvesafetyconcerns.PerformAnnualandSemi-annualinspectionofLifeSafetySystems.Write and provide inspection/service reports on tested equipment and devices.Indicate any deficiencies or corrections that need tobemade.Troubleshootanddiagnosefaultsormalfunctionsinfirealarmsystemsandtakeappropriate

Houston, TX 77021 • (41.5 miles) • Full Time • 9/8/2026

Benefits:401(k)Employee discountsBenefits/PerksCareer Advancement OpportunitiesCompetitive CompensationFlexible ScheduleJob Summary We are seeking a professional Security Guard to join our team. In this role, your primary responsibility will be to create a safe and secure environment. You will protect our premises, assets, and employees and prevent any illegal or inappropriate occurrences. The ideal candidate has experience with public safety and security and operates with a high degree of integrity at all times. ResponsibilitiesPatrol the premises and maintain a high level of visibilityMonitor entrances and exits to ensure only authorized personnel access the facilityRemove trespassers when necessaryMonitor surveillance camerasRespond to reports of suspicious activityReport on daily activ

Houston, TX 77002 • (39.7 miles) • Full Time • 9/8/2026

Description: We are ERock!ERock is a leader and innovator in distributed energy. ERock has responded to long-term trends in electricity by becoming the first smart-grid supplier to US energy consumers. The company installs, operates, and integrates its highly flexible, low-cost, and quick-response distributed generation to increase reliability and stability, reduce costs and decrease carbon footprint.At ERock, our backup generators ensure that customers will never be without power, allowing their business to operate normally when there is an outage in the area. Our innovative approach provides customers with highly reliable, ultra-clean backup generation at a fraction of the cost of traditional backup solutions. We seek those who share our commitment to customer service, innovation, and in

Houston, TX 77015 • (29.8 miles) • Full Time • 9/5/2026

*** THIS ANNOUNCEMENT MAY SERVE AS A CONTINUOUS ANNOUNCEMENT FOR ADDITIONAL VACANCIES FOR BOTH DAY AND NIGHT SHIFTS ***OverviewWe are seeking an Armed Security Specialist III to become an integral part of our team. In this position, you will be tasked to provide physical security, physical security inspections and entry access control at designated locations.A position with SENTRYSIX International is more than just a job, it’s the start of a great career. Joining the SENTRYSIX team means that you are joining an operational support and threat management provider to government and commercial clients worldwide. Because of this, we search for individuals of the highest caliber and experience.Veteran owned & operated company – Are you a Veteran? – We want to hear from you! APPLY TODAY!Responsib

Houston, TX 77001 • (34 miles) • Full Time • 9/4/2026

Zona Facta CollectivePosition: Level III ATM Protection AgentLocation: Houston, TX (Hybrid)Department: OperationsCompensation: $20.00/hour | Weekly Direct DepositEmployment Type: 1099 Independent ContractorJob OverviewZona Facta Collective is currently seeking qualified Level III Armed Security Agents for multiple security contracts across Texas. We have an immediate need for our ATM Technician Security Contract in the Greater Houston area. Agents will be responsible for escorting ATM technicians to ensure they can perform their tasks safely and without disruption.Key ResponsibilitiesEscort ATM technicians to and from job sites across the Greater Houston area.Ensure the safety of technicians during all assigned shifts.Remain on standby, ready to deploy at the start of each scheduled shift.

Houston, TX 77060 • (37.1 miles) • Full Time • 9/4/2026

NOW HIRING – SECURITY SERVICES SALES REPRESENTATIVE (B2B)Strategic Protection Solutions, LLC (SPS) | License #c19722Strategic Protection Solutions is seeking an experienced, results-driven Sales Representative to expand our client base throughout Texas. This is a high-impact, performance-based role for someone who already has a book of business or established client relationships in the security, property management, or facilities service industry.Position SummaryYou will be responsible for generating new leads, managing relationships, and closing service contracts for:Armed & Unarmed Guard ServicesVehicle & Foot PatrolsFire Watch & Emergency CoverageEvent & HOA SecurityCorporate, Retail, and Residential ClientsCompensationBase Pay:Commission: 5% on new signed contractsBonuses: Based on re

Houston, TX 77058 • (37.6 miles) • Full Time • 9/4/2026

Patriot Maritime are maritime government contracting companies providing management, crewing, and vessel support services to the U.S. government under contracts with MARAD and the Military Sealift Command (MSC). With approximately 83 shoreside employees and operations across multiple vessel programs including the Ready Reserve Force (RRF), Watson-class vessels, Bob Hope vessels, and other federal maritime programs Patriot operates at the intersection of commercial maritime expertise and federal government contracting. Headquartered in Houston, TX, our team supports the nation’s strategic sealift mission and military readiness.Patriot is seeking an experienced Cybersecurity Analyst / Engineer to build, operate, and mature the organization's information security program. The complexity of Pa

Houston, TX 77002 • (39.7 miles) • Full Time • 9/4/2026

The Loss Prevention Manager is responsible for overseeing the hotel’s loss prevention and security programs, including the prevention of theft, fraud, and vandalism. This position ensures the safety of guests, staff, and hotel property by implementing and enforcing security policies and procedures, investigating incidents, and working with local law enforcement as necessary.HOW YOU’LL SHAPE THE EXPERIENCE & FUTUREOversee day-to-day security operations, ensuring the safety and security of hotel guests, staff, and property.Investigate incidents of theft, fraud, or other illegal activities, compiling reports and working with law enforcement as required.Use and monitor surveillance systems, including CCTV cameras, alarms, and other security equipment to detect and respond to suspicious activit

Houston, TX • (40 miles) • Full Time • 9/4/2026

Armed Security Officer Houston, TX (North Cypress Area)Protect. Mentor. Lead.Serve with Purpose.Houston, TexasAt Tier One, we believe every person deserves to feel safe where they work, receive medical care, worship, or do business. As an Armed Security Officer, you'll be more than a uniform the calm professional who brings confidence during uncertainty, the trusted presence people rely on, and the first line of defense when safety matters most.If you've worn a badge, served in the military, worked in security, or simply feel called to protect others, you already understand that real security is about earning trust not just carrying a firearm.About the AssignmentThis position supports a healthcare and community-safety environment at a major medical campus in the Houston area. Officers assi

Beaumont, TX 77701 • (40.9 miles) • Full Time • 9/4/2026

Armed and Unarmed Officer Hiring:Best to email Resume & Guard Card to: Responsibilities and Duties: Security officer tasks may include but not limited to:Securing premises and personnel by patrolling property; monitoring surveillance equipment; inspecting buildings, equipment, and access points; permitting entry. Obtains help by sounding alarms. Prevents losses and damage by reporting irregularities; informing violators of policy and procedures; restraining trespassers, identifying risks and notifying appropriate management authority or 911/Police. Completes reports by recording observations, information, occurrences, and surveillance activities. Maintain a written log of all daily activities per shift.

Houston, TX 77054 • (44.4 miles) • Full Time • 9/4/2026

Now Hiring Event Staff at NRG Park!Company DescriptionS.A.F.E. (Security, Athletic Facilities & Events) Management is specifically tailored guest services, security, crowd management and parking staffing company that specializes in sport facility, special event management and 24/7 facility security.Description:S.A.F.E. Management is currently hiring! Are you looking for a part-time job where you can make your own schedule? Do you thrive working in a fast-paced exciting atmosphere and enjoy sporting events and concerts? S.A.F.E. Management is currently hiring part-time Event Staff Team Members to work at - NRG Park in Houston, TX!Summary ? Part-Time Event StaffS.A.F.E. Management's team members enjoy working sporting events, concerts, and other events. We strive to be friendly & considerate

Humble, TX 77338 • (29.7 miles) • Full Time • 9/2/2026

For the past 80+ years, M&Dhas led the aftermarket in remanufacturing innovation to address technological advancements and changing customer needs. In the past few decades, we have expanded beyond our remanufacturing roots to develop close (and sometimes exclusive) partnerships with the world’s leading OEMs and manufacturers.Those partnerships with key suppliers like Bosch, Garrett, Federal Mogul, Cummins, Stanadyne, Holset, BorgWarner, Delphi, Yanmar, Mitsubishi, Denso and others have been critical in honing our remanufacturing capabilities and expanding our parts offering to include new, no core options in fuel injectors and fuel pumps, diesel engine cylinder heads, blocks, crankshafts and connecting rods. M&D also stocks a complete assortment of turbos (new and remanufactured), inframe

Houston, TX 77017 • (36.6 miles) • Full Time • 9/2/2026

The incumbent must safely perform all functions associated with the General Description and Duties as indicated below. The incumbent will be required to have knowledge of Operating Specifications, Safety Procedures/Work Instructions, QSI System, Personal Protective Equipment, Emergency Response Manual, and Company Policies and Procedures.Must perform all duties and responsibilities with a "Safety First" attitude at all times.Use proper PPE as applicable to job-specific duties.For safety and business purposes, must possess strong verbal and written communication skills and be able to effectively communicate with employees, contractors, visitors, emergency responders, and members of the public. This position requires frequent interaction with the public and serves as a representative of G-3;

Houston, TX 77002 • (39.7 miles) • Full Time • 9/2/2026

Description: Mobile Security Officer (Flexible / Part-Time)JOB DESCRIPTIONAdvanced Sentry LLC is seeking professional and dependable individuals for flexible mobile security assignments across Texas. This role is designed for individuals who are comfortable working independently and accepting assignments based on their availability.WHAT YOU’LL DOPerform mobile security assignments at client locationsMaintain a visible and professional presenceObserve, document, and report incidents or unusual activityProvide professional customer service when interacting with residents, staff, or clientsCommunicate clearly with dispatch and team membersWORK STRUCTUREThis is a flexible, part-time role with no guaranteed hoursYou are not required to accept assignmentsAssignments are offered as they become av