Please Accept our Privacy Policy
Get Fast Shirt Apparel
Lawrenceville, GA • (31.4 miles) • Full Time • 9/27/2026
About Getfastshirt.comGetfastshirt.com is a fast-growing leader in the custom apparel and commercial printing industry, proudly delivering high-quality, versatile solutions for businesses, teams, events, and individuals. With a commitment to speed, precision, and customer satisfaction, we specialize in a full range of printing services including embroidery, direct-to-film (DTF) printing, screen printing. But we don’t stop at fabric. Our capabilities stretch across engraving, stickers, signage, and a wide array of commercial print solutions designed to elevate your image and message with precision and flair.Whether looking to outfit team with branded uniforms, create eye-catching promotional items, or bring unique design to life on apparel or signage, Getfastshirt.com combines advanced techAbsolics Inc
Covington, GA • (20.9 miles) • Full Time • 9/27/2026
Company DescriptionAbsolics Inc. is the world's first glass substrate manufacturer and a leader in advanced packaging technologies. The company provides scalable solutions tailored for businesses in high-performance computing. Absolics pioneers innovative manufacturing techniques to support cutting-edge semiconductor advancements. Located in Covington, GA, the company is positioned at the forefront of the technology industry.Position: SPC Data Control EngineerLocation:COVINGTON, GAJOBSUMMARYDUTIES/RESPONSIBILITIES:SPC System Design and ImplementationProcess Monitoring and ControlData Collection and ManagementData Analysis and InterpretationREQUIREMENTS:Excellent analytical and problem-solving skillsSolid understanding of quality management principles, root cause analysis, and corrective acRise Baking Company, LLC
Tucker, GA 30084 • (41.1 miles) • Full Time • 9/27/2026
Job PurposeSupport profitable business growth with key customers by managing and successfully delivering new product development (NPD) projects. Lead cross-functional teams to develop projects that meet customers’ expectations and ensure projects are commercialized on time and in full.Essential Functions• Deliver customer-driven NPD projects for key customers on time and in full• Align with Sales and R&D on clear project briefs and understand the customer’s NPD process and milestones to ensure their expectations are met• Create and manage project timelines, lead team meetings, identify resource requirements, set expectations, assign tasks and responsibilities, follow up, and track/report progress• Lead cross-functional project team through NPD process and ensure adherence to key milestonesProperty Medics Of Georgia LLC
Peachtree Corners, GA 30092 • (44.5 miles) • Full Time • 9/27/2026
Description: The Project Coordinator is responsible for ensuring all mitigation and restoration projects are properly documented, compliant, and administratively complete. This role supports Project Managers and Operations by verifying job files, maintaining claim accuracy, managing required communications, and ensuring all stabilization and mitigation documentation is completed in a timely and professional manner.Requirements: Primary Duties & ResponsibilitiesFile & Documentation ManagementVerify that all required job photos are uploaded and meet company and insurance documentation standards.Review files in MICA and other internal systems for completeness and accuracy.Ensure claim numbers are obtained and properly entered into each job file.Confirm that scope notes and job notes have beenAutomation Personnel Services
Dacula, GA • (27.8 miles) • Full Time • 9/27/2026
ASOCIADO DE LOGSTICA Y ALMACN Automation Personnel Services est buscando un Asociado de Logstica y Almacn para una empresa ubicada en Dacula, GA. En este puesto, tendr la oportunidad de desarrollar sus habilidades en logstica, control de inventario y manejo de materiales mientras forma parte de una compaa lder a nivel mundial en soluciones para la industria de la construccin. Salario $18.50 por hora Horario y Turno Lunes a Viernes, 12:00 PM – 8:30 PM,con horas extras segn sea necesario. Almuerzo: 4:00 PM – 4:30 PM Responsabilidades y Deberes delAsociado de Logstica y AlmacnRecibir, inspeccionar y procesar materiales devueltos por los clientes.Identificar y evaluar las condiciones de equipos y componentes devueltos.Tomar fotografas y documentar las devoluciones segn los procedimientos estabTHE UPS STORE
Lawrenceville, GA • (31.4 miles) • Full Time • 9/26/2026
The Graphic Designer is responsible for following through on all customer graphics orders and will help with volume copying. In addition to effective conceptualization abilities, strong design skills, and technical expertise, the Graphic Designer must be highly collaborative by nature and must have demonstrated strengths in graphics design, project management, and communication. The ideal candidate has a Bachelor’s degree in visual communication, graphic design, or a related field; at least two years of experience in graphic design or in the print industry, and is skilled in copy-editing/proof-reading and desktop publishing. He or she must have full mastery of various software design programs including Adobe-based platforms (Acrobat, InDesign, Illustrator, and Photoshop) for both Mac and PAVASO Technology Solutions Inc
Norcross, GA 30093 • (40 miles) • Full Time • 9/26/2026
JobDescriptionSummary:TheITFieldTicketCoordinator’sresponsibilitiesaretoreceive,validate,schedulewithcustomer,plan,andassignticketstodesignatedfieldtechniciansforpartspick-upsandhardwareITrepairservices.TheITfieldticketcoordinatorwillcommunicatedirectlywiththedesignatedfieldtechniciansresponsibleforservicesaswellaswiththeend-customersrequestingservice.TheITFieldTicketCoordinatorwillberequiredtoadheretocontractualServiceLevelAgreements(“SLAs”).KeyResponsibilities:Receive, validate, update, and end-user requests for hardware repair services via ticketing system and in compliance with contractual SLAs.Schedulerepairserviceswithend-usersviaphoneand/ore-mail.Planandassigndesignatedfieldtechnicianstoend-userserviceticketsasefficientlyaspossible.Providecustomerservicesupportviaphoneand/ore-mail.CGeorgia System Operations Corporation
Tucker, GA 30084 • (41.1 miles) • Full Time • 9/26/2026
Senior Energy Systems Analyst III - IVDesign, Support, and Improve Critical Energy Billing and Settlement SystemsGeorgia System Operations Corporation (GSOC) is seeking a Senior Energy Systems Analyst to provide functional and technical ownership of the applications, data processes, controls, and business rules that support accurate and timely Member billing, energy settlements, contract calculations, and related reporting across the Family of Companies.This role combines business systems analysis, application development, data analytics, and technical leadership to ensure critical energy billing and settlement solutions remain accurate, reliable, scalable, and audit-ready.The Senior Energy Systems Analyst designs, develops, supports, and improves solutions using Excel/VBA, SQL, MicrosoftHydro North America
Gainesville, GA 30501 • (44.1 miles) • Full Time • 9/26/2026
Hydro Extrusions is a world-leading aluminium extrusion business counting around 100 production sites in 40 countries and employing 20,000 people. Through our unique combination of local expertise, global network, and unmatched R&D capabilities, we can offer everything from standards profiles to advanced development and manufacturing for most industries.Since 1905, Hydro has turned natural resources into valuable products for people and businesses with focus on a safe and good workplace for our 30,000 employees in more than 140 locations.What we offer youMedical, Rx, Dental, Disability, Life Insurance, Flexible Spending AccountsRetirement Savings Plans with Company Match/ContributionsEducation AssistanceBonus Plan EligibilityParental LeaveWhat you will be doingJob Summary: The ReliabilityDCCM
Gainesville, GA 30501 • (44.1 miles) • Full Time • 9/26/2026
Description: We are seeking a highly experienced Senior Project Manager to lead land and site development projects throughout Georgia. This role is responsible for managing all phases of project deliveryfrom due diligence and entitlement through design, permitting, and construction supportwhile maintaining strong client relationships and ensuring successful project outcomes.The ideal candidate will bring in-depth knowledge of Georgia development regulations, strong leadership skills, and experience managing complex commercial, residential, and mixed-use projects.Key ResponsibilitiesProject Management & DeliveryLead and manage multiple land and site development projects simultaneouslyOversee project scope, schedules, budgets, and quality assuranceDirect multidisciplinary teams including civActalent
Conyers, GA 30012 • (27.8 miles) • Full Time • 9/26/2026
Job Title: Senior Project ManagerJob DescriptionAs a Senior Project Manager, you will lead and consult with owners, general contractors, engineers, architects, vendors, subcontractors, and project stakeholders. You will be responsible for nurturing successful relationships to ensure project success and client satisfaction. You will manage the pre-construction, pre-planning, procurement, and construction project scheduling process. Your role will involve leveraging strong relationships with clients, contractors, and project partners to support successful project execution and future business opportunities.ResponsibilitiesManage subcontractors to ensure project timelines, budgets, quality standards, and client expectations are met.Take ownership and accountability for projects under your dirAerotek
Suwanee, GA • (38.6 miles) • Full Time • 9/26/2026
Job Title: Test TechnicianSuwanee, GA Pay: $19-$25/HourShift: 6a-5:30PMJob DescriptionThe Test Technician performs routine and specialized electrical tests on transformers, power metering products, power distribution units, and other integrated systems to verify that all products meet defined specifications. This role troubleshoots and resolves manufacturing and design issues in a timely manner to support product quality and customer satisfaction, while contributing to continuous improvement in processes and practices.ResponsibilitiesPerform routine and special electrical tests on transformers, power metering products, power distribution units, and other integrated systems to ensure products meet specifications.Assist in the assembly of products by reading and following electrical schematiRaba Kistner Inc.
Decatur, GA 30035 • (39.6 miles) • Full Time • 9/26/2026
Raba Kistner, Inc. is a premier Engineering Consulting and Program Management firm. Our purpose is to build a better and more sustainable world for our employees, their families, our clients, and the communities we serve. Our Core Values are:Community “We care for our communities”Integrity “We act with integrity”Passion “We infuse passion into everything we do”Quality “We believe quality comes from a culture of innovation and continuous improvement”Growth “We dedicate ourselves to personal and business growth”Raba Kistner is seeking a dependable Project Manger IIto join our Infrastructure team in Decatur, GA. Under direction, responsible for all areas or project operations, as determined by the size and nature of the project, including construction inspection and material testing operationRenesas Electronics
Duluth, GA • (41 miles) • Full Time • 9/26/2026
Job Description Job DescriptionPropose, architect, and design RTL in Verilog for use in a mixed-signal integrated circuitContribute as part of a highly experienced team of engineers with extensive cross-functional skill setApply clocking controls, FSM design, low power techniques, and high-speed design conceptsParticipate in design, architecture, and verification reviewsOversee digital backend design, including synthesis, static timing analysis, and logic equivalence checkingCreate documentation targeting design, verification, and test teamsAssist with the proposal, definition, documentation, and implementation of new featuresMentor and train junior engineers and New College Grad engineersQualifications QualificationsEducation:Bachelor or Master's degree in Electrical Engineering, ComputerPrime Retail Services, Inc.
Flowery Branch, GA 30542 • (38.3 miles) • Full Time • 9/25/2026
Prime Retail Services is a nationwide retail construction General Contractor helping brands bring their spaces to life with precision and professionalism. Since 2003, we’ve delivered retail construction solutions for Fortune 500 companies and growing brands across the United States.The Construction Senior Project Manager leads project teams and day-to-day operations to deliver projects safely, on time, within budget, and to client expectations. This role requires strong leadership, financial discipline, client communication, procurement oversight, and the ability to develop team members while driving operational excellence and change.ESSENTIAL FUNCTIONSManage people, processes, and daily project operations to execute assigned projects successfully.Assign and monitor team responsibilities wOglethorpe Power Corporation
Tucker, GA 30084 • (41.1 miles) • Full Time • 9/25/2026
Role SnapshotThis position is responsible for the complete execution of Capital Projects. It encompasses all aspects of project functions including project development, engineering/design, procurement, construction, budget/actual management and reporting, commissioning, startup and testing of capital projects that are required at new generation sites or OPC's existing power generation fleet with a capital expenditure over $10 million. This position may be responsible for managing multiple simultaneous projects. This position directs projects to ensure safety, environmental, budget, and schedule goals are met. This position may be responsible for the management of contracted project managers based on active project volume within the PMO.Works directly with Supervisor/Contractors/Project TeaRealTruck Group Inc
Pendergrass, GA 30567 • (32.6 miles) • Full Time • 9/25/2026
POSITION SUMMARYThe Senior Software Engineer will spearhead the development of software solutions in logistics. This position will play a crucial role in shaping the technical direction of projects and ensuring the overall success of software development initiatives within the organization. This individual will leverage their expertise to design, implement, integrate, and maintain systems for efficient processes within the assigned function area (i.e. manufacturing, distribution, finance, etc.). This position will lead and collaborate with cross-functional and international teams to drive innovations.CORE FUNCTIONSLead the design and architecture of complex software systems, ensuring scalability, maintainability, and performance.Lead cross-functional and international teams.Collaborate witNational Vision
Lawrenceville, GA 30043 • (33.9 miles) • Full Time • 9/25/2026
Company Description At National Vision we believe everyone deserves to see their best to live their best. We help people by making quality eye care and eyewear more affordable and accessible. National Vision is one of the largest optical retail companies in the United States with over 1,200 stores. We operate four retail brands: America’s Best Contacts & Eyeglasses, Eyeglass World, and Vista Optical inside select Fred Meyer stores and on select military bases. We offer an innovative culture where training is a priority, hard work is praised, and career growth is a reality.We are hiring for a Sr Manager, Oracle Fusion Applications to join our growing team!Job Description We are seeking an experienced, highly skilled Sr. Manager, Oracle Applications to serve as the senior techno-functional oUSAN
Norcross, GA 30071 • (42.1 miles) • Full Time • 9/25/2026
Applicants must be authorized to work for ANY employer in the U.S.We are unable to sponsor or take over sponsorship of an employment Visa currently.No agencies please.This hybrid role requires onsite presence at the Norcross HQ twice per week.USAN is an innovative contact center solutions provider, a respected community leader, and an all-around great place to work. We promote work-life effectiveness for all our employees by creating a supportive, flexible, and collaborative work environment. We have a high-performance culture, where we treat our employees as individuals, as professionals, as key members of the team, and like family.We are seeking highly motivated DevOps people to join a small, fast-moving DevOps team responsible for building, automating, securing, and operating cloud-natiH.A. Sack Co, LLC
Norcross, GA • (42.1 miles) • Full Time • 9/25/2026
Description: About usSack is redefining the industry, experiencing explosive growth year after year with no signs of stopping! As the fastest-growing MEPF, millwright, and rigging company in the South, we’re building the future with innovation. We offer competitive pay, great benefits, and the perfect place to launch and grow your career.Job ResponsibilitiesWe are seeking an Electrical Project Manager to join our construction firm. As part of our team, you oversee multiple crews and implement the installation of large-scale electrical systems. You manage work sequencing, interpret blueprints and schematics, and ensure safe and timely completion of all projects. This role requires strong leadership and organizational skills, and our ideal candidate possesses significant prior experience orgBatchelor & Kimball
Ellenwood, GA 30294 • (43.4 miles) • Full Time • 9/25/2026
As a leading mechanical contractor serving the Southeast and Midwest, Batchelor & Kimball takes pride in partnering with our clients to deliver excellent results from engineering and construction to operations and maintenance. We offer design/build and turnkey construction services, including teaming with subcontractor partners. If you are looking to grow your career and thrive in a team environment, then we invite you to apply for this position.There’s not a lot of BS here, and not a lot of turnover. Good people work at Batchelor & Kimball. We’re good at our jobs, and good to each other. We have high expectations because the work is challenging, but we know the most valuable thing about the work is the people who do it. If this sounds like a good fit for you, we’d like to meet you!If youSystem One
Athens, GA 30601 • (20.9 miles) • Full Time • 9/24/2026
Job Title: Pharmacovigilance Systems Analyst Location: Athens, GA Type: 21 month contract Compensation: $30-34/hour, depending on qualifications Work Model: Onsite – onsite Hours: 40.0OverviewProvide operational and administrative support for pharmacovigilance systems, including system maintenance, user support, data management, validation activities, and documentation. This role supports global PV users and ensures the reliable operation of GxP-regulated safety systems.ResponsibilitiesProvide first-line support for pharmacovigilance system users, including ticket triage, user setup, access support, mailbox management, and training coordination. Maintain pharmacovigilance system data, including product dictionaries, product families, product lines, and related database records. Execute SQLJHB-CUI
Lawrenceville, GA 30046 • (31.3 miles) • Full Time • 9/24/2026
Entry-Level Cable TechnicianNo Experience Required | Paid Training | Company Vehicle | Weekly PayBuild a Career That Connects PeopleLooking for more than just another job? Want a career where you're paid to learn, work independently, and have unlimited earning potential?At CUI Cable Services, we're looking for motivated individuals who enjoy working with their hands, solving problems, and helping customers stay connected. Whether you're starting your career or looking for a fresh opportunity, we'll provide the paid training, tools, and support you need to become a successful Telecommunications Technician.No cable experience? No problem. If you have a great attitude and a strong work ethic, we'll teach you everything you need to know.Why You'll Love Working at CUIWe Invest in Your SuccessDIGIOFFICE
Duluth, GA 30097 • (41.6 miles) • Full Time • 9/24/2026
Benefits:Opportunity for advancementTraining & developmentWellness resources DigiOffice is seeking a sharp, self-directed Intune Endpoint & Mobility Engineer with proven, production-level hands-on experience in both Microsoft Intune and VMware Workspace ONE / AirWatch. This is a dual-platform engineering position not a monitoring role, not a ticket-routing role. You will own, operate, and troubleshoot a complex enterprise endpoint and mobility environment supporting a national logistics and transportation operation where device uptime directly impacts freight movement and business continuity. If you have built, administered, and independently troubleshot both Intune and Workspace ONE in production and can solve complex endpoint problems without step-by-step direction this role was writtenWEG Electric Corp
Duluth, GA 30097 • (41.6 miles) • Full Time • 9/24/2026
WEG Coatings Manitowoc, WICompany Description: WEG Coatings LLC., located in Manitowoc, WI, is a privately owned and operated company that custom formulates, develops, manufactures, sells, and applies high-performance coatings. These include Phenolics, Epoxies, Epoxy Phenolics, Urethanes and Polyesters. Founded in 1935, the company is the manufacturer of the finest corrosion control coatings and serves customers world-wide.We are a service-oriented company that strives to be on the cutting edge of the coatings industry. We take great pride in the satisfaction of our customers thus requiring a dynamic, personable, independent individual who can work well with our customers and staff. WEG Coatings is made up of a talented, versatile team focused on continuous improvement.The Data Entry ClerkEDAG, Inc.
Avondale Estates, GA 30002 • (42.9 miles) • Full Time • 9/24/2026
Description: WHO WE ARE Working together, growing together, creating new things together: EDAG connects people and the future. Company and workforce share the same vision. With a familiar atmosphere and at the same time the potential of a global world-class development company. You‘ll go your own way in your career at a high level – nationally and internationally. Take your next step and support us as a VEHICLE ENGINEERING PROGRAM MANAGERDESCRIPTIONLead and manage a team of program analysts, providing guidance, support, and mentorship to drive exceptional performanceLead problem-solving activities for engineering challenges, leveraging competitive benchmarking, business case analysis, cost & weight initiatives, and market/customer analysisPrepare and deliver frequent reports to upper- andNEOVOLTA POWER LLC
Pendergrass, GA 30567 • (32.6 miles) • Full Time • 9/24/2026
Benefits:401(k)401(k) matchingCompetitive salaryTraining & developmentNeoVolta Power, LLC is building one of the next-generation battery manufacturing platforms in the United States and we’re looking for talented individuals to help power the future of energy. Our Georgia facility is designed for gigawatt-scale production of advanced battery energy storage systems supporting AI data centers, renewable integration, and grid stability. Backed by strong industry partnerships and global technical expertise, we offer the unique opportunity to join a high-growth manufacturing environment where your work directly shapes the future of clean energy infrastructure. At NeoVolta Power, we foster a culture grounded in fairness, transparency, compliance, and respect for every employee’s contribution becKelso Industries
Jackson, GA • (40 miles) • Full Time • 9/24/2026
Together We Build – Partnership, Innovation, Excellence, and SafetyAt Kelso Industries, 5,000+ employees across 40+ companies work together to deliver exceptional HVAC, mechanical, plumbing, refrigeration, and electrical solutions nationwide. Join us to grow your career, make an impact, and be part of a team where innovation, excellence, and safety come first.Recruiter Notice: We respectfully ask external recruiters and staffing agencies not to submit candidates. We only accept direct applications.Wallace Electric Company is actively seeking an "Accomplished" AND "Results-Driven" Project Executive for their operations team. Our ideal candidate will have a proven track record and stable employment history. The Project Executive is responsible for the overall leadership, strategic direction,Wallace Electric
Jackson, GA • (40 miles) • Full Time • 9/24/2026
We're not just offering a job, we're inviting you to be part of a team built on PARTNERSHIP, INNOVATION, EXCELLENCE, and SAFETY at Wallace Electric.PARTNERSHIP means we work together with trust, loyalty, and an owner mindset, always striving for win-win outcomes.INNOVATION drives us to think differently and create real value in everything we do.EXCELLENCE pushes us to set high expectations and deliver exceptional results.SAFETY is our foundationboth physical and psychological safety matter every single day.If you're looking for a place where you can grow your career, be valued for who you are, and contribute to something meaningful, we'd love to have you on our team.We are part of Kelso Industries, which is comprised of 25+ (and growing) market-leading operating companies with over 2,600 eUnited Merchant Services
Duluth, GA 30096 • (40 miles) • Full Time • 9/24/2026
United Merchant Services, Inc. (dba Bluu) is a New Jersey-based, comprehensive payment processing company for merchants nationwide. UMS continues to introduce innovative payment products and services to merchants and its commitment to excellent customer service has made UMS one of the top private payment processors in the nation.We are looking for an Application Processor with Excel experience to join our Team!Responsibilities Receive, review, and enter data in a payment service or POS application into internal and external systems during a new account boarding process in accordance to established procedures. Prepare for source documents for underwriting Communicate with business partners and customers to resolve incomplete application packages Data entry on the systems of processing relatReeves Young LLC
Buford, GA 30518 • (40.3 miles) • Full Time • 9/24/2026
What We’re AboutAt Reeves Young, everything we do – from 30 feet below the ground to 30 floors above – is about people. The culture we cultivate spreads throughout our employees and flows into the relationships we build with our clients, owners, and business partners. We pride ourselves in celebrating the accomplishments of our staff and promoting growth through challenging our employees each and every day. Whether it’s in the boardroom or at the ping-pong table, we are making an impact on the construction industry. Don’t just read what we’re about, join our team and see for yourself. What We OfferAmazing Coworkers Competitive Pay Full Benefits including Medical, Dental, Vision and more 401(K) Matching Paid Time Off Company Celebrations & Events Office Snacks On-Site Fitness Facility WhatSBT Global, Inc.
Duluth, GA • (41 miles) • Full Time • 9/24/2026
Company Description Salary rate: $80,000~/yr, DOELocation: Duluth, GAEmployment Type: Full-timeWork Arrangement: On-site**Korean Bilingual Required**Job Description We are seeking a Connected Car Service (CCS) Operations Developer to support the operation, maintenance, and enhancement of connected vehicle services and related data-processing systems.This position will focus on processing large volumes of data using Python, supporting ETL workflows, and developing and maintaining Java-based applications. The ideal candidate will have experience in backend development, data processing, system operations, and technical troubleshooting.Key ResponsibilitiesSupport the daily operation and maintenance of Connected Car Service systemsProcess and manage large volumes of data using PythonDevelop andSK AX USA Inc
Duluth, GA 30097 • (41.6 miles) • Full Time • 9/24/2026
Infrastructure Network Engineer Location:Duluth, GA (On-site) Job Type: Full-Time Salary: Based on experienceBenefits: 100% Employer Paid Medical, Dental, Vision | 401K Match | PTO & Holidays | Paid Lunch | Relocation Assistance | Bonus Opportunity About Us SK AX USA, Inc. is a leading global IT service provider and subsidiary of SK Group, one of South Korea’s largest conglomerates. Our U.S. Headquarters supports a range of industries, including IT consulting, digital transformation, and cloud services. We are looking for a skilled Infrastructure Network Engineer to join our IT infrastructure team and support mission-critical network operations. Learn more about SK AX USA: https://www.skaxus.com Position Overview We are seeking a highly skilled Infrastructure Network Engineer to design, imWabtec
Norcross, GA • (42.1 miles) • Full Time • 9/24/2026
Job Description About theRole:Weareseekinga highly skilled and innovativeSystemsEngineer/ Lead Systems Integratortojoinour Systems and Design organization, responsible for end-to-end engineering functions across all major disciplines, including systems engineering, hardware design, mechanical engineering, electronics, and cross-functional integration. This role is pivotal in driving the development and customization of ourKinetiXWayside Inspection products to meet specific customer needs and enhance overall product performance. TheSystem Engineerwilljoina group of talented engineers from multiple disciplines and collaborate closely with product managers, architects, and third-party experts to deliver high-impact solutions.Key Responsibilities1. Product Design & StandardizationOwn and evolvEDAG
Avondale Estates, GA 30002 • (42.9 miles) • Full Time • 9/24/2026
WHO WE ARE Working together, growing together, creating new things together: EDAG connects people and the future. Company and workforce share the same vision. With a familiar atmosphere and at the same time the potential of a global world-class development company. You‘ll go your own way in your career at a high level – nationally andinternationally. Take your next step and support us as aVEHICLE ENGINEERING PROGRAM MANAGER.DESCRIPTIONLead and manage a team of program analysts, providing guidance, support, and mentorship to drive exceptionalperformanceLead problem-solving activities for engineering challenges, leveraging competitive benchmarking, business caseanalysis, cost & weight initiatives, and market/customer analysisPrepare and deliver frequent reports to upper- and executive-levelCoastal Talent Solutions
Atlanta, GA 30340 • (43.8 miles) • Full Time • 9/24/2026
Senior Project Manager – Commercial Roofing (New Construction) Atlanta, GA | Large-Scale Commercial Projects | Leadership OpportunityA Bit About Us We are one of the fastest-growing commercial roofing contractors in the Southeast, partnering with top-ranked general contractors on large-scale new construction projects including data centers, distribution centers, and major commercial developments.Our reputation is built on execution, accountability, and long-term relationships with some of the most respected general contractors in the industry. As we continue expanding in the Atlanta market, we are seeking a Senior Project Manager to lead complex commercial roofing projects and support the continued growth of our Georgia operations.Why Join Us? Salary: $120,000 – $160,000+ (based on experieSoloPulse
Peachtree Corners, GA • (44.2 miles) • Full Time • 9/24/2026
SoloPulse Corp is a dual-use radar company committed to the relentless exploration of the frontiers of radar sensing technology. Located in Atlanta, GA, SoloPulse stands as a venture-backed startup, diligently cultivating strategic collaborations to proactively address critical safety imperatives and emerging autonomy needs across both civilian and military domains. Our distinguished team encompasses accomplished engineers, seasoned advisors, and experienced startup veterans, collectively driven by an overarching mission to change the way the world sees. We are looking for a senior software engineer to build the real-time processing systems at the core of our radar platform. This is an R&D-focused role where you will take algorithms and system concepts and turn them into high-performance,FST Technical Services
Decatur, GA 30030 • (44.6 miles) • Full Time • 9/24/2026
Lead the Delivery of Mission-Critical Infrastructure That Powers the WorldAt FST Technical Services, wedon’tjust support projectswe ensure that the most critical facilities in the world perform flawlessly from day one. Our commissioning teamsoperatein high-performance environments across hyperscale data centers where precision, reliability, and execution are non-negotiable. We are seeking a Commissioning Manager – Data Center Operations (Cx) who thrives in fast-paced environments, leads from the front, and takes ownership of complex project outcomes.Why Top Talent Chooses This Role You will: • Lead high-visibility, mission-critical data center projects • Operate with real ownership and decision-making authority • Influence both project delivery and operational strategy • Work alongside higAlcanza Clinical Research
Decatur, GA 30030 • (44.6 miles) • Full Time • 9/24/2026
DescriptionAlcanza is a growing multi-site, multi-phase clinical research company with a network of locations in AL, AZ, FL, GA, IL, MA, MI, MO, NV, VA, SC, TN, TX and Puerto Rico. We have established a strong presence across Phase I-IV studies and several therapeutic areas including vaccine, neurology, dermatology, psychiatry, and general medicine. Join us as we continue to grow. The Data Entry Coordinator works to ensure the execution of assigned studies in compliance with GCP, ICH, HIPAA, FDA Regulations, and SOPs.Key ResponsibilitiesEssential Job Duties: In collaboration with other members of the clinical research site teamwork to ensure the entry of clinical visit data in EDC and other clinical data software/systems. Responsibilities may include but are not limited to:Managing data enBailey Nurseries
Winterville, GA 30683 • (21 miles) • Full Time • 9/23/2026
About the OpportunityLocation: Bailey Nurseries locationsSchedule: Seasonal, full-time internship opportunities may vary by location and departmentFLSA Status: Non-Exempt – Paid InternshipGrow Your Future with Bailey NurseriesAt Bailey Nurseries, we believe our people are the root of our success. That's why our internship program is designed to do more than provide work experience. We offer meaningful opportunities for students to learn, contribute, build professional skills, and explore career paths in an innovative and growing organization.Whether you're passionate about horticulture, business, technology, marketing, operations, or people, you'll gain hands-on experience working alongside industry professionals who are committed to helping you grow.As a Bailey Nurseries intern, you won'tSigma Systems, Inc.
Duluth, GA • (41 miles) • Full Time • 9/23/2026
37676383 Data Analyst V, Duluth, GA 1 year Contract Sigma, Inc is looking for a Data Analyst V to work onsite at our client's location in Duluth, GA. Note : Flexibility exists to work out of any of the BIAH sites (Athens GA, Johns Creek GA, Gainesville GA, St Joseph MO, Ames IA)Duties :Performs Pharmacovigilance signal detection and analysis including generation of monthly and quarterly trending reports.Performs data analysis and report generation for ad hoc requests for PV information to support regulatory authority requests and stakeholder support (marketing, quality, external customers, etc.).Contributes to other PV product surveillance and risk management activities as needed SkillsPerforms Pharmacovigilance signal detection and analysis including generation of monthly and quarterly tr